SecReT6
Protein ID: 386590164
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0921
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1061320..1061805 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDI0A5N3
KEGG IDshb:SU5_0921
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|386590164|ref|YP_006086564.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1061320-1061805 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCGAACAAAGAAATTTAA
 Primer design