SecReT6
Protein ID: 386590165
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0922
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1061918..1062409 [+]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDI0A5N4
KEGG IDshb:SU5_0922
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-41, Aligned region: 5..155
Protein Sequence: 163 a.a.     [Download]
>gi|386590165|ref|YP_006086565.1| Type VI secretion lipoprotein/VasD [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIP
GKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1061918-1062409 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTAAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCG
GGGAAAGGAAAAGTGCAGTTGGAGGCGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAAT
GA
 Primer design