SecReT6
Protein ID: 386590166
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0923
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1062413..1063756 [+]
ProductType VI secretion protein
NoteTssK
UniProt IDI0A5N5
KEGG IDshb:SU5_0923
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-138, Aligned region: 20..445
Protein Sequence: 447 a.a.     [Download]
>gi|386590166|ref|YP_006086566.1| Type VI secretion protein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFP
DGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRG
AQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLI
RMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRP
QTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLA
IKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1062413-1063756 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAGCTGGAATGACCGCGTAGTCTGGAGTGAAGGACAATTTTTACTGCCGCAGATGTTTCAGCAGCAAG
AGCGTTATCTGGAACACGTCATGCATTACCGCAGCCTGCCGCTGACCCCCTTTTTCTGGGGATTCAGCCA
CTACAATATTGATGGCGAAGCGCTGAACATCGGTAAACTGATACTGAAAGAGGCATCAGGGATTTTTCCT
GACGGCACGCCGTTTAACGCACCGGACCACACCCCGCTGCCGCCGCCGCTGACCATCCTGCCGGAGCACC
TGAACCAGCAGATTTGTCTGGCGGTACCGGTACGCGCGCCGAACAGCGAAGAAACCACGTTTGACAATAA
CCCGGAATCACTGGCGCGTTTCTCGGTACATGAACACGACATCCGCGACGCCAACTCGCTGGGACGTGGC
GCGCAGTTATTACAGCTCAGTCATCTGCGCCTGCGGCTGCTGCCGGAAAAGGCTGTGACGGGCGCCTGGA
TTGGCCTGCCGTTGACCCGCATCACCGGGTTGAACCCTGACGGGCGGATAGATATCGACCACGACCTGAT
CCCGCCCATCATTAATTATCAGGCCAGTTCACTGATGTGTACCTGGCTGTCGTGGATCAACGATCTCATC
CGGATGCGGGCCGATTCGCTGGCGGAACGGTTGACCGGCAGCGACAACCACGGCCATGAAGCAGCGGAGG
TCTCCGATTACCTGCTGCTGCAAATTCTCAATCGCTTTGAGCCGCTGCTGACTCACCTGGCGAAAACCCC
GCTGGCCCCGGAAGTGTTGTATCGCTACCTGTCCGAACTGGCCGGGGAACTCTCCACCTATGTGCGTCCA
CAAACGCGACGGCCCGCTGAATACAAAGAGTACAAACACCTGACGCCCTATGCCGGGTTGAAATCGCTGG
TTGATGAGGTGCAGTTCCTGCTGAACGCGGTACTGATCCGGGGCGCGCAGCGCATCGAGCTGAAAGAGGG
GACTTACGGCATCCTGAATGCGGTGGTGGCTCCTTCCGATCTTGCCGATTTCAGCACGCTGGTACTGGCG
ATAAAGGCTTCAATGCCGACCGATGTGCTACTGCAACATTTTGCCGCCCAGACCAAAATCGGGCCATCCG
ATCGCCTGCCGGAACTGATCCGCTCGCATCTGCCGGGGCTGGCTTTGCAGGTTCTGCCTGTACCACCGCG
CCAAATCCCGTTTCAGGCCGGATACATCTATTACGACATCCGCCGCGAGGGAGCATTGTGGGAACACATT
GCCCGTTACGGCGGGATGGCCATGCATACCGCCGGGGAATTTCCGGGGCTGGAGACAGAACTGTGGGGAG
TGCGCGATAAATGA
 Primer design