SecReT6
Protein ID: 386590167
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0924
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1063753..1065057 [+]
ProductType VI secretion system OmpA/MotB
NoteTssL
UniProt IDI0A5N6
KEGG IDshb:SU5_0924
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.60E-61, Aligned region: 62..266
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 193..211
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|386590167|ref|YP_006086567.1| Type VI secretion system OmpA/MotB [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAAANPLLAAARP
LLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGI
WAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQL
LTQLSQRRDPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDA
IGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAARE
IARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1063753-1065057 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGACAGACAGTACCCTGACGCCGCCAGCGGCGGACATGATGTCCTTTTTGTCCACCACGCCGGAGCATA
AGGACAGTGAATATGAAACGCCGGTACACACCAGCCAGCGCACGGAACTCAATGTCATCGTTGAAGACGG
TCCGGACAGCAAACTCCGGCTGGCTGAAATCAGCGCGGCGGCTAACCCGTTGCTCGCCGCTGCCCGGCCT
TTATTGTGCGCTCTCGCAGCCATGCCCGCTAAACTGGATGCGGCCCTGGTAGAGCCTTACCGTAATCTGT
TGGTACGCGAGATGCATCTGTACCAGACATTATGCGATCAGGCGAACCTGCGGCGCGAGCACGTACTGGC
GGTACGTTACTGCCTGTGTACGGCGCTTGATGAAGCCGCCAATAACACAACCTGGGGACGGCGCGGCATC
TGGGCCGGAAAAAGCCTGCTGGTAACATTTCATGGTGAAAGCGAAGGCGGGATAAAACTTTTCCAGATCA
TCGGGCGTCTGGCGGCCAGCTTCCAGGAGCATGGCAACGTACTGGAGGTTATCTACCACCTGCTGGGGTT
GGGATTTGAAGGCCGCTACAGCGTGCAGCCAGACGGGCGTAAGCAACTGGACAATATTCGCCAGCAACTG
CTGACACAGCTTTCACAGCGTCGCGATCCGGTAATGCCCGCGCTCTCGCCTGACTTTCAGGGGGCGATAA
GCGGACGACTGCGGCGGATGCGCCGGGTGCCGGTCTGGCTGAGCGCCGGGATAGCCCTGTTGGCGATGCT
GACGCTGTTTGGCCTTTACAGCCACCGGATGGATGTGCAGACCGTCACCGTACAACAGCATATTGATGCG
ATTGGTATAAAACTGCCGCCGCCGCCCGTGCCGGTTCATAAGCTGCGGCTGAAAATCCTGCTGGCAAACG
AAATCGCCCGTGGCCTGCTGACCGTGGACGAAGATGACCAGCACAGTAGGGTGGTCTTCCGTGGCGACGC
CATGTTTGTGCCGGGACAGAAAACGGTGAGTGACGCAATCCGGCCAGTGATTAACAAAGCGGCGCGGGAA
ATCGCCCGCGTGGGCGGCGCAGTCACTGTAACGGGTCACACTGACAGCCAGCCCATTCATTCGGCTGAAT
TCCCATCCAACCTGGTGCTGTCGGAAAAACGGGCGGCGGAAGTTGCGGCGTTGCTGACCTCCGGCGGCGT
ACCTGCCGGACGGGTACATATCGTCGGCAAGGGCGATACGGTGCCGGTGGCGGATAACGGCAGTAAAGCC
GGGCGGGCGAAAAACCGTCGGGTGGAAATTCTGGTAGTGGAGTGA
 Primer design