SecReT6
Protein ID: 386590170
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0927
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1066503..1070372 [+]
ProductType VI secretion protein IcmF
NoteTssM
UniProt IDI0A5N9
KEGG IDshb:SU5_0927
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-93, Aligned region: 588..916
ImcF-related_N [PF14331], Evalue: 2.90E-92, Aligned region: 263..541
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 446..482
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1025..1146
Protein Sequence: 1289 a.a.     [Download]
>gi|386590170|ref|YP_006086570.1| Type VI secretion protein IcmF [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVGMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRT
LTSHLRAQIWGFTLPYSRRRKTGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASL
PHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDY
LNEISARATRLDGEVKAYTGKPAMAPVPTLLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLY
NRLLDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDS
VAGFGGRAAVLTHIEALFDGSRVVHSPYEKNEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLV
RAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAV
VEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQ
SGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKI
NAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDP
WRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAH
GPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3870 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1066503-1070372 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCGATTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGCAGCCG
GGTGGTGACCATTGCCCTGTTGCTGATGTTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACCCTGATTGGTTTCATCCTGCTGATGTACGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCTGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AACTGCGGCAGTTGCGGGTGGGCATGCCCGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGCGATGGCAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACCTCGCGTATCCTGACAGTGCCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCAGTGTTGATTGATACGGCCGGACGCTACGCCCGCCACGATGA
CGGCGGCGAAGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGGCGGCCTGCGCAGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGAT
TCGCTTTCCGGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAGTATTTTCGCACG
CTGACCAGCCATCTTCGCGCACAAATCTGGGGCTTCACGTTGCCGTACAGCCGCAGGCGAAAAACGGGCG
ACCCGCAGGCGCTGCATGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTGCGGCTGGATCAGGGACT
GGATACCCGGTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTC
GCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGC
AACTGAATAACACGCTGCGCGGGGTGTTTTTCACCAGCGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGA
CCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCCTCCGCCTCTCTC
CCACACGCTCTGCCGGACGGCAACCGCAGCTACTTTCTGCATGACCTGCTGACACAGTTTATTTTCCGTG
AAGCGCACCTGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCT
GCTGGTACTGGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTAT
CTGAATGAAATCAGCGCCCGCGCGACCCGGCTGGACGGCGAGGTGAAAGCCTACACCGGTAAACCGGCGA
TGGCTCCCGTCCCGACACTGCTGGATAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGC
GCCGCCGCTGACCTGGCGCTACGGCCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTAC
AACCGTCTGCTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCA
TTGCCCGTCAGGACAGTAAAGCTGCGTATGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGA
TCACGAAGATAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGC
GTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGG
TGCATTCACCGTATGAGAAAAATGAGGCACTGATCCGCCAGGCGCGGGCATTCCTCGACGGTCACACCAG
TACCGAGCGTATCTATGCGCGGGCGCTGGCGGCGATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTA
CGCGCCGTCGGCGCGGATGCGGGAACGGTGTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGC
CGGGTATTTTTACCCGTGAAGGATACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGC
GACGGCGAACGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGC
CAGATACCGGGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACGGAATATGCCCGCC
GCTGGCAGGATTTTCTGGACAGTATCCATAGTATCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGC
CTATGATTTACAGGTGCTGCGCACCCTGGCGTCGCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTG
GTGGAGCAGACCACGCTGGTGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAGCTGGCGCAGCGCGCAT
CCGGTAACGCGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGA
AAAAACGCTGGTGGATGACCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAG
AGCGGCGGTGGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCA
TTGCTGATAGCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGA
GGCGGCGAAACTGCCTGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATC
AACGCCGGGACCGGCGACGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCA
TCGACGGGCGCTATCCGTTCGCCGACAGTCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGC
CAGCGGCGGCGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCG
TGGCGCTACAAACCGACCGAAGGCAACATGACGTTGCAGGGGCCGGATTTAACGCCGTTTCAGCAGGCGA
AGCAGATCCGCAGCGTATTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGT
GGTGGATATGGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGCCAGGTGCTGCGCTACGCCCAT
GGTCCGGACCGTCCCCTGAAAGTAACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCA
GCCCGCGTATTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGA
CGCCGGAATGGTACAGGAAACGGCGGTGCGGGGGCGCCAATTGGTGGAATATGATTTTGACGGTCGCCGG
GTGGTGCTGGAAATCACTGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTT
GTCCGGCGAGGGCGTTGTAA
 Primer design