SecReT6
Protein ID: 386590175
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0932
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1073584..1075815 [+]
ProductVgrG protein
NoteTssI
UniProt IDI0A5P4
KEGG IDshb:SU5_0932
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 120..428
Phage_GPD [PF05954], Evalue: 6.80E-80, Aligned region: 632..646
Phage_base_V [PF04717], Evalue: 9.30E-26, Aligned region: 466..558
Protein Sequence: 743 a.a.     [Download]
>gi|386590175|ref|YP_006086575.1| VgrG protein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNL
GYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDYK
AFQNKSVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLV
LADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETG
HATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLMQ
TLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKV
QFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGL
PGAATQSGIYSHTIGGGPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIAT
IGAVRDHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNITATDADG
QINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE
 
Nucleotide Sequence: 2232 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1073584-1075815 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATAGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAAGCCGCCGTGGA
ACAGGCTGCGGGATCGCTGTTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTGGCAGCG
GCGCAGGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCCGCTGTTGCAGGCGGGC
CGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCTGGA
CGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAATCTG
GGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACATCG
AACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGAAGG
GCGTTCGGTTACCTATGAGCTACGTATGGAGCCGTGGCTGAAACTGCTGACCCATACCAGCGACTACAAA
GCATTCCAGAATAAAAGCGTGGTGGATATTCTGGATGAAGTGCTGGCGGAATACCCCTACCCGGTGGAAA
AGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTTTCT
TCAGCGACTGATGCAGGAGTGGGGCATCTATTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTGGTG
CTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAGGGC
TGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGTCTGCGGACTGGACAGTGGGTGCT
GGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACGGTGGCAAACCCGCGTGAAACCGGT
CATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGACGC
GCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACTCAT
GACCGGTTATACCTTCACGCTGGAAAACTATCCCACTGCCGAAGTCAATCAGGAATACCTGCTGATGCAG
ACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCCGTT
TTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGGGCC
GCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAGGTA
CAGTTTGGCTGGGATCGCTACGGCAAAATGGATGAAAACAGCTCTTGCTGGATACGCGTCAGCTACCCAT
GGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAAAAA
CGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGACTG
CCGGGCGCGGCAACACAGAGCGGGATATACAGCCACACTATCGGCGGCGGACCGACCAATGCCAACGCCC
TGCGTTTTGAAGATAAACCCGGTAGTGAAGAGGTCTGGCTACATGCTGAAAAAGATCAGCGTATTGAAGT
TAATAATAATGAAAGTCACTGGGTGGGGAATAATCGGGTTAAGGTCATTGATCAGTCAGAAATAGCCACT
ATTGGCGCTGTCCGCGACCATAAAGTTCAGTATGACGATACCTCTCTGGCCGGAGGAAATAAAACCATTC
AGACGGTAAAAGAGTTATATCTGGCAGCGGGTGATTCTATTACTCTGAGTTGTGGTGACACCGTTCTGTA
CATGAGCAGTAAGGGGGAATTTTACGTAACCTGTAAAACGTTCAATATTACTGCAACAGATGCCGATGGT
CAGATTAATACTATAAAAGGGCAGCTGGATTTAAATATGGATAAAAGAGAACCCAAAGTGGGAACATTTG
GTGAGTCAGAAAAAACAGCAATGGCAGCAGTAATTAAGGAAACTTTCCCACCCAAAGAATAG
 Primer design