SecReT6
Protein ID: 386597962
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0221
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]243345..243824 [-]
Producthypothetical protein
NoteTssD
UniProt IDD5CVE4
KEGG IDeih:ECOK1_0221
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|386597962|ref|YP_006099468.1| hypothetical protein ECOK1_0221 [Escherichia coli IHE3034]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESIN
WEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c243824-243345 Escherichia coli IHE3034 chromosome, complete genome
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGG
TCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCT
CTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCT
TTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCTCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGTCCAGGGCAGGCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAT
TGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA
 Primer design