SecReT6
Protein ID: 386597963
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0222
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]243842..245200 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDD5CVE5
KEGG IDeih:ECOK1_0222
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 91..156
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 258..271
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 288..434
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 254..261
Protein Sequence: 452 a.a.     [Download]
>gi|386597963|ref|YP_006099469.1| ImpA domain-containing protein [Escherichia coli IHE3034]
MSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLAR
TRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERA
LQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPL
PDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWL
ASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQ
ARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c245200-243842 Escherichia coli IHE3034 chromosome, complete genome
ATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGCG
CCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACGT
ACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAAT
GGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCGG
GAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGCT
TTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTTT
ATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGAC
CATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCTA
CCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGCG
ACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGCA
GGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTTG
GCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCGC
TGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAGC
CAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACAA
GCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAGGGTTTCACCC
TATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACCT
GCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGATCAACGAA
CGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAACA
GAACCGAACCTGTCCATCCAACTCATTGA
 Primer design