SecReT6
Protein ID: 386597964
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0223
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]245211..248678 [-]
Producthypothetical protein
NoteTssM
UniProt IDD5CVE6
KEGG IDeih:ECOK1_0223
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-83, Aligned region: 487..800
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 190..437
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 817..863
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 285..303
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 896..1014
Protein Sequence: 1155 a.a.     [Download]
>gi|386597964|ref|YP_006099470.1| hypothetical protein ECOK1_0223 [Escherichia coli IHE3034]
MPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAVWGLIALVWLTWRVMKRLQKL
EKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTLLREGFPSD
IVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQPLNGLILT
LDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDRDAILGVT
FTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIVTALLAALLDG
ENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLAEPNLAGE
NSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPPPQGTDEFGNLQLPL
LNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPESEEKL
AVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSDSDAVSRW
TPYDKPIINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFDNVFVAGNDEKLVIPQFLTRY
GLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYISDYTATWRAGMDNLNVRDYEA
MSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEMDYRLLSRLGHEFAPENSALE
EQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWV
GKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDASLDSFERFFKPDGILDNFYKN
NLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFAVETVSLSGNKRRSVLNLDGQ
LVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRF
NVDGGAMVYQVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3468 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c248678-245211 Escherichia coli IHE3034 chromosome, complete genome
ATGCCGCGGTTTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCT
GGTGGCAGGGTCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGC
GACCGCCGTCTGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTG
GAAAAACAGCAGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGC
AATATCTGGATCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCC
GTGGTATATGGTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGAC
ATTGTTTACACGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACC
AGGCGGTAATTTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCT
GCGCGAACACTGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACG
CTCGATCTTCCCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGC
AACTTCAGGAGATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCT
GCTGAACGGCTTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACA
TTTACCCGCCGCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTAC
AACAGGTGAACCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTT
CAGCTTCTCCCGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGT
GAGAACATGGATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATA
TTTTCACGCAGTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGA
GACGACGCCGTATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAA
AACAGCGTCTGGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGG
CATTGATGGTCGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACA
AGCTAAAGCCTTTATGGACGTACCACCACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTG
CTTAACCCGGTACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGG
GATTGTACCAGGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTA
TCTCCCCTCGTTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTC
GCTGTGCTGCGCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACA
TGGCACGGCGCTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGA
CTATGCGCTGGAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTCAGCCGCTGG
ACCCCCTATGATAAACCGATCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCT
ACCAGACCCTGCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCC
CACCTTCGACAACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTAT
GGACTGCAAAGCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTAC
TGAACCTGACGCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACA
GTACATCAGTGACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCC
ATGTCGGCGCTGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGG
CGCTGCGCGATAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCGAT
AAATGAGATGGATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAG
GAGCAAAAGGACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGC
TGGCGATCCAGAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAA
CAGCAGCGATCCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTA
GGTAAGCTCGCGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGC
GCGACAATGTAGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACA
GGATGCCTCACTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAAC
AACCTGCGCCTGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATA
TCCGGCAGCAACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGC
ACAGTTTGCCGTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAG
TTAGTGGACTACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCA
ATGAAAGCAAGCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGTGGACCGTG
GGCGCAGTTCCGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTT
AACGTGGACGGCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTC
TGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAA
 Primer design