SecReT6
Protein ID: 386597965
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0224
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]248758..250200 [-]
Producthypothetical protein
NoteTssA
UniProt IDD5CVE7
KEGG IDeih:ECOK1_0224
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 406..417
Protein Sequence: 480 a.a.     [Download]
>gi|386597965|ref|YP_006099471.1| hypothetical protein ECOK1_0224 [Escherichia coli IHE3034]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c250200-248758 Escherichia coli IHE3034 chromosome, complete genome
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA
 Primer design