SecReT6
Protein ID: 386597967
SecReT6 ID622
T6SS typei1
Gene symbolclpB
Locus tagECOK1_0226
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]250945..253704 [-]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDD5CVE9
KEGG IDeih:ECOK1_0226
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.70E-39, Aligned region: 255..255
AAA_2 [PF07724], Evalue: 8.70E-39, Aligned region: 639..800
AAA [PF00004], Evalue: 1.90E-16, Aligned region: 221..332
AAA [PF00004], Evalue: 1.90E-16, Aligned region: 645..762
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 40..74
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 644..764
ClpB_D2-small [PF10431], Evalue: 1.90E-11, Aligned region: 806..882
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 428..484
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 465..484
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 615..685
AAA_16 [PF13191], Evalue: 1.20E-07, Aligned region: 710..738
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 451..478
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 643..678
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 639..673
AAA_25 [PF13481], Evalue: 2.10E-05, Aligned region: 771..836
AAA_14 [PF13173], Evalue: 0.0001, Aligned region: 220..319
AAA_14 [PF13173], Evalue: 0.0001, Aligned region: 644..734
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 38..71
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 638..666
NACHT [PF05729], Evalue: 0.00016, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.00016, Aligned region: 440..449
NACHT [PF05729], Evalue: 0.00016, Aligned region: 645..673
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 642..669
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 205..237
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 645..663
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 106..123
AAA_18 [PF13238], Evalue: 0.0062, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.0062, Aligned region: 645..679
Zeta_toxin [PF06414], Evalue: 0.0074, Aligned region: 220..239
Zeta_toxin [PF06414], Evalue: 0.0074, Aligned region: 455..497
Zeta_toxin [PF06414], Evalue: 0.0074, Aligned region: 643..684
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 220..240
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 645..679
Protein Sequence: 919 a.a.     [Download]
>gi|386597967|ref|YP_006099473.1| ATP-dependent chaperone protein ClpB [Escherichia coli IHE3034]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLARYAKNMTADARNGRLDPVLCRNYEIDLMIDI
LCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVIFSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAI
NLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLEQYDETLSALDELEVAWQQQTLVQE
IIALRQQLLGVAEDDVASLPDADAVEDTPPEAEQDSTDAESADDAGSVQPEETAETVSPVQRLAQLTAEL
DALHNDQLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGGTIKGQDLAIASLHKHLLTA
RADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYG
EGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVE
HADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPEV
TDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAVT
PQTEDETVL
 
Nucleotide Sequence: 2760 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c253704-250945 Escherichia coli IHE3034 chromosome, complete genome
ATGATCCAGATTGATTTAGCCACGCTCGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATGTGCTGTTACAGATGCTGGC
AATCCCGCGCAACGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGTGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGCGACCAGTTACAGCAGGATTTCGCAGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GCGGGCAAACGCCCCGCGCAACGGAAACCGGCGACACCCTGCTTGCCCGCTACGCCAAAAACATGACCGC
AGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCAACTATGAAATCGACCTGATGATCGACATT
CTCTGCCGCCGCCGTAAAAACAATCCGGTGGTAGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGTGCGTCGGTGAAAGGTGAGTTTGAAAAACGCTTCAAGGGGCTGATG
GCGGAGGTCATTTTCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATATCCAACCTGCTCAAACCAGCGCTGGCGCGCGGCGAGCTGAAAAC
CATCGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATGCAGCTTTGTCGCGCCGCTTC
CAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTTTGTCGGCGGTCT
ATGAACAATCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACACTGAGCGAGCGTTA
TCTCTCCGGGCGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGACACCGCCTGCGCCCGTGTGGCCATC
AACCTGTCATCGCCGCCAAAACAAATCTCGGCACTGACCACCCTGAGCCACCAGCAGGAGGCAGAAATTC
GCCAGCTTGAGCGCGAGCTTCGCATCGGGCTGCGTACCGACACCTCACGAATGACTGAGGTGTTGGAGCA
GTATGATGAAACGCTGTCGGCGCTGGACGAACTGGAAGTCGCCTGGCAGCAGCAGACGCTGGTACAGGAA
ATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAAGACGACGTTGCGTCGTTGCCGGACGCAGATG
CCGTGGAGGATACGCCGCCAGAGGCAGAACAGGATAGTACCGATGCCGAATCGGCTGATGATGCAGGCAG
CGTACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGGCTGGCACAACTCACTGCCGAACTG
GACGCCCTGCATAACGACCAGTTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGATTG
CTGAATGGACCGGCGTGCCGCTTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGACCTGCCGGT
ATGGCTCGGCGGCACCATCAAGGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACCGCA
CGCGCCGACCTGCGCCGTCCGGGACGCCCGCTTGGTGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTA
AAACCGAAACCGTCCTGCAACTGGCGGAACTGCTCTATGGCGGACGTCAATACCTGACCACCATCAATAT
GTCTGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGCTCTCCTCCGGGTTATGTCGGCTACGGT
GAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTCGATGAAGTAGAAA
AAGCGCACCCGGATGTACTCAACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCAGACGGTGAAGG
CCGCCTGATTGACTGTAAAAATATCGTTTTCTTCCTGACCTCCAACCTTGGCTACCAGGTGATTGTCGAA
CACGCCGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTGCTC
TGCTGGCGCGCATGGAAGTGGTGCCTTACCTACCGCTGTCGAAAGAGACGCTCGCTACCATTATTGCCGG
GAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGGGCCGGAAGTG
ACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTTATCGACG
GCGACATGCTGCCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCGGAT
TCGCCTGTCGGCGGCAGACGGTGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTGACA
CCGCAAACAGAGGACGAAACGGTTTTATGA
 Primer design