SecReT6
Protein ID: 386597968
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0227
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]253714..254478 [-]
Producthypothetical protein
NoteTssL
UniProt IDD5CVF0
KEGG IDeih:ECOK1_0227
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.10E-62, Aligned region: 33..237
Protein Sequence: 254 a.a.     [Download]
>gi|386597968|ref|YP_006099474.1| hypothetical protein ECOK1_0227 [Escherichia coli IHE3034]
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFTQVVTDVQ
AVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIR
EPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQL
IRRLTIKHVLCGGLVVLTVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 765 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c254478-253714 Escherichia coli IHE3034 chromosome, complete genome
ATGAGCGATATGAGTGAAGCGTCGGTTTTTCCCGTGGAGCCGGAGAGCGGAACACCAGGACGCCAGTACC
GTCTCGCCCTTCGCGGCAACAGCCTGAATCCAATGATTGACGCCGCCACGCCGTTGCTCGGCATGGTGAT
GCGTCTGTCCACTATGAACAGTCAGGCCATGCCGGAACATCTGTTTACCCAGGTAGTAACCGATGTCCAG
GCCGTAGAGCAACTACTCCAGGAACAGGGATACGAACCGGGCGTCATTGTTTCGTTCCGTTACATTCTCT
GCACGTTTATTGATGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATCAAACAGTCGCT
GCTGGTTCATTTTCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGCCTGATCCGG
GAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGTTTTTCGCTCGGCTTTCGCGGGCGCT
ACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGCCCTGCACAA
ACTGCGCGGTGACGCGCCATTTCCGCTACTTCATCAGAAGAACAACATACAGGGTGGGCGTTATCAGTTA
ATCCGACGACTGACCATCAAGCATGTACTGTGCGGCGGTCTTGTTGTGCTGACCGTATTTTATCTGTTTT
ATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCGATAA
 Primer design