SecReT6
Protein ID: 386597971
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0230
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]256353..257633 [-]
Producthypothetical protein
NoteFha
UniProt IDD5CVF3
KEGG IDeih:ECOK1_0230
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00096, Aligned region: 40..104
Protein Sequence: 426 a.a.     [Download]
>gi|386597971|ref|YP_006099477.1| hypothetical protein ECOK1_0230 [Escherichia coli IHE3034]
MAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGA
YCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDSLADT
LLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANGINTP
FMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQ
QNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRV
MLDAFSPGNLMRRFAQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLRET
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c257633-256353 Escherichia coli IHE3034 chromosome, complete genome
ATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATGGCAACGAACTGG
AAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATACGCCGGAATGTCA
CTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGGCACGACGGAGCC
TATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCGATGCGCTCATCC
GCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCATGACGGTGCAGC
TGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGTCTGGCGGACACC
CTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTGCCCCCACGGTGG
CGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGCAGATGATCCGAT
CGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGGATCAACACGCCG
TTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCATGGCGCAGTACC
ACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTCTCAGGATGCGGA
TGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGTCTGCAACAACAA
CAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCGTTGCGCCTTGATATGGACTATG
CCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACCTGCGGCCATCGC
CGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGCGATTGTGGAAGCGTTGCGTGTC
ATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCAGCCATGAACTGC
GCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAGCTGGCCTCCAGCCG
ACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTGCTGCGCGAAACA
CAGCGGGAGCCGGAAGCATGA
 Primer design