SecReT6
Protein ID: 386597972
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0231
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]257650..258699 [-]
Producthypothetical protein
NoteTssG
UniProt IDD5CVF4
KEGG IDeih:ECOK1_0231
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-90, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|386597972|ref|YP_006099478.1| hypothetical protein ECOK1_0231 [Escherichia coli IHE3034]
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSSDASISFPGTD
LSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLSDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c258699-257650 Escherichia coli IHE3034 chromosome, complete genome
ATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAGCGACAAAACCGCCGTTACCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGCATGGCGCGCCGGGCCAGGACATTTCCCT
GCGTACCGAGCCTGCCCGGGAGATCGTGCGTTTCAGCTCTGACGCCAGTATCAGTTTTCCGGGTACGGAC
CTGAGTGCGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGGTTCCTGGGTTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAGCGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTGGCGCCACAGCAGGCTAAAGGGATGCGCCTTAGCGATCCGGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA
 Primer design