SecReT6
Protein ID: 386597973
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0232
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]258663..260504 [-]
Producthypothetical protein
NoteTssF
UniProt IDD5CVF5
KEGG IDeih:ECOK1_0232
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|386597973|ref|YP_006099479.1| hypothetical protein ECOK1_0232 [Escherichia coli IHE3034]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
INAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|386597751|ref|NC_017628.1|:c260504-258663 Escherichia coli IHE3034 chromosome, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGCTAGGCAAACTGCTGGCGC
AGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAGTTCACCCATGGG
CTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGCCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCGGCGGGTT
TTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
ATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGC
ACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCCAGGCGCGTGTCTGGCCCG
AATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGTG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG
 Primer design