SecReT6
Protein ID: 386597980
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0239
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]267523..268962 [+]
Producthypothetical protein
NotePAAR
UniProt IDD5CVG2
KEGG IDeih:ECOK1_0239
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.60E-23, Aligned region: 14..116
Peptidase_C39 [PF03412], Evalue: 4.90E-07, Aligned region: 352..474
PAAR_motif [PF05488], Evalue: 6.50E-05, Aligned region: 78..106
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 354..391
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 431..455
Protein Sequence: 479 a.a.     [Download]
>gi|386597980|ref|YP_006099486.1| hypothetical protein ECOK1_0239 [Escherichia coli IHE3034]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAG
KGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTA
EVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFG
ENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLIN
GQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLD
SNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|386597751|ref|NC_017628.1|:267523-268962 Escherichia coli IHE3034 chromosome, complete genome
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTG
AAGTAGGAGGTTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAAC
GGTATGGGCGCGTGGATGCAGAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGT
AAAGGTGTCATATCCGGTACATCTCAAGGAACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAA
CAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGTTGGGATTAATAACCACAACTGCCTTGGTAA
ATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTTTTAATTATGAAAGGACTGCT
GAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGACGGAGATATTT
CACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGA
GAGAACACACTTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAG
TTACATTCGATGCTCTGTTAGATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATG
TGAACAGGCAAATATAAATTTAAATGAAAAAGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAAT
GGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATACAAATAATGGTGATCAGATTGCTCTGGAGC
ATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAAGAAAATATCTCTGGGAAAGT
ATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGAGGTTTTAGAT
TCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCT
TAATAAATTTGATGTCGGCTGGGAAGGGAATGCAGTGAGCGAATCTAGTTTATATGCCCTCAGTAATACT
GGTTCATGGGGAGCAATGATGTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTG
ATGATGCTGGGAATGTGATAATATATGATCCATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATT
TAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA
 Primer design