SecReT6
Protein ID: 386597993
SecReT6 ID622
T6SS typei1
Gene symbol-
Locus tagECOK1_0253
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]281972..282742 [+]
Productputative chemotaxis protein
NoteTagL
UniProt IDD5CVH5, D5CVH5
KEGG IDeih:ECOK1_0253
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.00E-15, Aligned region: 64..82
OmpA [PF00691], Evalue: 2.00E-15, Aligned region: 115..208
Protein Sequence: 256 a.a.     [Download]
>gi|386597993|ref|YP_006099499.1| putative chemotaxis protein [Escherichia coli IHE3034]
MIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHLPKPATVAVPEETEKKARDVNEKTALLKKKS
ATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAKIMPFFKTLLVELAPVLDS
LDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPENKVMQVSAMADQMLLDAKNPQSAGN
RRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRAR
 
Nucleotide Sequence: 771 bp     [Download]
>gi|386597751|ref|NC_017628.1|:281972-282742 Escherichia coli IHE3034 chromosome, complete genome
TTGATTGTCAACAGCGTCAGTAAATCCGAGCGTGAAAGCATTATCGCCGCGCTGCACGGGCAGTCGATTT
TTAACGGTGGTGGGTTGTCGCCGTTAAATAAAATCAGCCCGTCTCATCTGCCAAAACCTGCCACCGTGGC
GGTGCCGGAAGAGACGGAGAAAAAAGCGCGCGACGTCAACGAGAAAACGGCGCTGTTGAAGAAGAAATCC
GCCACCGAGCTTGGCGAGCTGGCGACCAGTATCAATACCATCGCCCGTGATGCGCATATGGAAGCGAATC
TGGAGATGGAGATTGTTCCCCAGGGATTACGCGTGCTGATTAAAGACGACCAGAACCGCAATATGTTTGA
ACGCGGCAGCGCGAAGATTATGCCGTTCTTTAAAACTTTGCTGGTGGAGCTTGCGCCAGTGTTAGACTCG
CTCGATAACAAAATTATTATTACCGGGCATACCGATGCGATGGCCTACAAAAACAATATCTACAACAACT
GGAACCTTTCGGGCGATCGCGCGCTTTCGGCTCGTCGGGTGCTGGAAGAGGCCGGAATGCCGGAAAATAA
AGTGATGCAGGTAAGCGCAATGGCGGACCAGATGCTGCTGGATGCCAAAAATCCGCAAAGCGCGGGCAAC
CGGCGCATTGAGATTATGGTGCTGACCAAAAGTGCGTCCGATACGCTGTATCAATACTTTGGTCAGCATG
GGGATAAAGTGGTGCAGCCGCTGGTGCAAAAGCTGGATAAGCAGCAGGTGCTTTCGCAGCGAGCGCGTTA
A
 Primer design