SecReT6
Protein ID: 386600817
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3204
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3272102..3275455 [+]
Producthypothetical protein
NoteTssM
UniProt IDD5CZA1
KEGG IDeih:ECOK1_3204
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 400..717
IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 779..822
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 434..467
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 840..959
Protein Sequence: 1117 a.a.     [Download]
>gi|386600817|ref|YP_006102323.1| hypothetical protein ECOK1_3204 [Escherichia coli IHE3034]
MHTQRYGFWGYLILIIGLAGICALLIIINQDVLIKSGVSARLIWGIWAGLFSLFLLGVVCSPFWWIRKQR
KAQFIYRPKNSAENDQPVSSPSEDILTDLSSNIRLRYGPFWRRKVRLLLVTGEPEEAEAIAPGLTGQHWL
EGDHTVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRELINGGKRLGFQA
PLYLWQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLADNRHDFLLRLAHTL
AERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNARGRTVGFPWL
RTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREG
APWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKAL
LMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKIL
LRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVV
TARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMAD
ARQSPLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGNEPVGPLDKTFAPLLRLLG
DKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASL
GEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLR
DDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKP
ACDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQ
VTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3354 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3272102-3275455 Escherichia coli IHE3034 chromosome, complete genome
ATGCATACTCAGCGTTACGGTTTCTGGGGATATTTAATTCTGATTATTGGTTTGGCAGGGATTTGCGCTC
TGTTAATTATTATTAATCAGGATGTTCTGATAAAGAGCGGAGTGTCTGCTCGTCTGATATGGGGAATATG
GGCGGGATTATTTTCTCTTTTTTTACTTGGGGTTGTGTGTTCGCCGTTCTGGTGGATCCGGAAGCAAAGG
AAAGCGCAATTTATTTACAGACCAAAAAATTCGGCAGAAAACGACCAACCCGTATCTTCTCCATCAGAGG
ATATTTTAACCGATCTCAGCTCAAATATTCGGTTACGCTATGGTCCGTTCTGGCGGCGTAAAGTCCGCCT
GCTGCTGGTGACCGGCGAGCCTGAAGAGGCAGAGGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTG
GAGGGCGACCACACCGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCG
CCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGCCGCTGACAGAAGAACAAAGCCG
CCAGACCGCACAACTCGACAAAGGCTGGCGCGAACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCT
CCACTCTATTTGTGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCT
GCCTGCTGCCGGAACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGAC
GGAACAGGGCATGTCGCAACTGCTGGCGGATAACCGCCATGATTTCCTGCTGCGTCTGGCCCATACCCTT
GCAGAGCGGGGTATCGCTCACTGGCAAAGCGTTCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCC
TGCGCCTGCGTGGCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGGCCGCACCTCATGCGTGGCT
GCCGTCACCGGTCTGGGCGGGCGTGACGGGTGATAACGCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTG
CGTACCGCACTGATGTCCGCTGTCTGCGTGCTGGTGATATGGGGGGCCGGAATGACGACCTCGTTCTTCG
CCAACCGCGCTCTTGTTCAGGAAACCGGTATCCAGACGGCGCGTGCGCTCGATACCCGCCTGCCGCTGGC
AGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGCGAAGGT
GCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCTTTTCCCGGCTATG
CGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTTAATGCCTTTGT
CGCGCTGCCGCCCAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTG
CTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCGGACGGTCTGC
GCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACCTTCTGGACGGCGAA
CCTGCCGGAACACCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAGTGCGTAAAATCCTG
CTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCA
ACTACGCCGATATGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACA
GACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTG
ACGGCGCGGCGCGAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGC
CGGATACGCTGCGTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCT
CAACAGCATTCGCTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGAT
GCCCGTCAGTCGCCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGCAGGCAGGGAAAACC
GTGGCCTGTCAGACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCA
ATCCCGTGAAGGCAACGAGCCTGTCGGGCCGCTGGATAAAACCTTCGCGCCGCTACTGCGGTTGCTGGGC
GATAAGGCAGGAGGCGGTGGTGGTGATACGCAACTCAGCCTGCAAACGTATCTGACCCGCGTCACCCGCG
TGCGTCTCAAACTGCAACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGAC
GGTTTTACAGGGCAAAACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTG
GGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGC
TGACGCCTGCGGCGGACAGCCTGAACCGTCAGTGGCAGCGGGCGATAGTCAGCCACTGGAATCAGGACTT
CGCCGGGCGCTATCCGTTCAAAGCCTCACAAAACGATGCCTCTCTTCCCCTGCTGGCACAGTATCTGCGC
GATGACGGGCGCATCAACCAGTTTATCGCCGCCAACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACT
GGGTGGCTGACGCCATGAACACGCAGGGGCTGACGGTTAACCCGGACTTTATCCGCGCCCTGAACCGCCT
GCGTGACGTGGCCGACACCGCCTTTGCCAGCGGCGATGCGGGAATACATTTCGAACTGCGGGCAAAACCG
GCGTGTGACGTGATGAAAACGCATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAGGAAC
GCTGGCAGCGTTTCAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGCACGCA
GGCGATGGAACGCATTCTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAG
GTGACACCGGTGGACAGCAGCACCTTTAAGGTGGTGTGGAAAGCGCAGGATGGCCTGCCGCTGAATTACC
TGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACA
GGTATTTCTGACCGGCAGGAGTATGAAGGATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design