SecReT6
Protein ID: 386610191
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3042
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3119688..3123125 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8Q0T3
KEGG IDelw:ECW_m3042
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.40E-66, Aligned region: 428..745
IcmF-related [PF06761], Evalue: 3.40E-66, Aligned region: 808..849
DUF1215 [PF06744], Evalue: 1.40E-35, Aligned region: 462..495
DUF1215 [PF06744], Evalue: 1.40E-35, Aligned region: 868..987
Protein Sequence: 1145 a.a.     [Download]
>gi|386610191|ref|YP_006125677.1| hypothetical protein ECW_m3042 [Escherichia coli W]
MGDRGVAIRFPTGGIIVVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAG
VIAAGVVFLIIMGVYHLLNRHAAVQNFELRRQLAAGDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWR
RNVRLLLVTGEPEQAEAIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVTLLTALKKLRRSRPLDGIIWALT
EEQSRQTAQLDKGWRELINGGKRLGFQAPLYLWQVCDNGDYQAGRPLQSVGCLLPERCTPEQLTAMLEAH
TLPLTEQGMSQLLADNRHDFLLRLAHTLAERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLTAVPEAA
PHAWLPSQVWAGVTGDNARGRAVGFPWLRAALMSAVCVLAIWGAGMTTSFFANCALVQETSIQTARALDT
RLPQAEQLVALHTLQGELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQ
LNAFVALPPNSPQRTATGEQRYKQLKALLMTSRPEKADAAFFSTTLMADSLRYENIPEGVRQSVFPSLLT
FWMANLPEHPQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESL
FSTEQTVPGMFTRQAWEGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFTGS
WLAFLNSIRWKKEDSLSGILDQLTLMADARQSPLIALTDTLAWQAAAVRENRGLSDSLAKSAQELFNGKE
KTPQQSREVDVPVGPLDKTFAPLLRLLGDKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQ
QLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSH
WNQDFAGRYPFKASQNDASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIR
ALNRLRDVADTAFASGDAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLS
WTSTQAMERILADYRGSWSLIRLLEQAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNF
RLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3119688-3123125 Escherichia coli W chromosome, complete genome
ATGGGCGACCGTGGTGTCGCCATTCGTTTCCCCACAGGAGGCATCATAGTGGTTCCGGGATTAAACCGTC
TCCGGCCCCGTTCTGTTTCAGGGCCTGCCATCGTCATGACCGTGGCTGTTGTGGTTGCGCTTTGCACGTT
TATTCACCGTAAACCGGCATTGCTGGGCGTTGAACCGGGTAGCTCACAGCAAATGTACTGGATGGCTGGC
GTGATTGCCGCAGGCGTGGTCTTTTTGATTATCATGGGGGTTTATCATCTGCTGAACCGCCACGCTGCCG
TACAAAACTTTGAACTCCGCAGACAACTTGCCGCCGGAGATGACTATCGTGCGGTGACGACAAAGAAAGC
CGACAGCCGTCATCCGGCAATGGTGGAACTCGCCGCCTTCCTGCGCGACCGCTACGGTCCGTTCTGGCGG
CGTAACGTCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCG
GGCAACACTGGCTGGAGGGCGACCACACGGTGCTGATATATGGCGGCAGGCCATCAGCGGAGCCTGATGT
CACACTGCTGACCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGGCGCTGACA
GAAGAACAGAGCCGCCAGACAGCGCAACTCGACAAAGGCTGGCGCGAACTGATAAACGGCGGTAAGCGAC
TCGGTTTTCAGGCCCCACTCTATTTGTGGCAGGTCTGTGACAACGGTGATTATCAGGCCGGACGCCCCCT
GCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGCACCCCGGAACAACTGACCGCCATGCTGGAAGCTCAC
ACCCTGCCGCTGACGGAACAGGGCATGTCGCAACTGCTGGCTGATAACCGCCATGATTTTCTGCTGCGTC
TGGCCCATACCCTTGCAGAGCGGGGTATCGCTCACTGGCAAAGCGTCCTGAAACCGCTGCTGGCAGGCGG
CGCATTCTCTTCCCTGCGCCTGCGTGGTCTGATGTTCAGCCCGCCGCTTACCGCCGTACCGGAGGCCGCA
CCTCATGCGTGGCTGCCGTCACAGGTCTGGGCGGGCGTGACCGGCGATAACGCACGGGGGCGTGCAGTGG
GCTTTCCGTGGCTACGCGCCGCGCTGATGTCCGCTGTCTGCGTGCTGGCAATATGGGGGGCCGGAATGAC
GACCTCTTTCTTCGCCAACTGCGCTCTTGTTCAGGAAACCAGCATCCAGACTGCACGTGCGCTTGATACC
CGCCTGCCGCAGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAACTGGAGCGCCTGCAATATC
GTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCAGCCGC
CTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAA
CTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGC
AGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGAT
GGCAGACAGCCTGCGCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGTGTTTCCGTCACTGCTGACC
TTCTGGATGGCGAACCTGCCGGAACACCCGCAGTGGAAAACCTCGCCGCCACCGGAACTGACCGGCGCGG
TGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACTCTCTACCAGAACGTACTGCA
ACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTT
TTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCA
TCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTGCTCAGCGACCGCCAGCAGGATACCTC
TGCGGATATATCGCCGGATACGCTGCGTAACCGTCTCACCTCACGCTACTTTACCGACTTCACCGGAAGC
TGGCTGGCGTTTCTCAACAGCATTCGCTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGA
CACTGATGGCCGATGCCCGTCAGTCGCCGCTGATTGCGCTGACCGATACCCTCGCGTGGCAGGCGGCGGC
AGTCAGGGAAAACCGTGGCCTGTCAGACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAG
AAAACGCCGCAGCAATCCCGTGAAGTCGATGTGCCTGTCGGGCCGCTGGATAAAACCTTTGCTCCGCTGC
TGCGGTTGCTGGGCGATAAGGCCGGAGGCGGTGGTGGTGATACGCAACTCAGCCTGCAAACGTATCTGAC
CCGCGTCACCCGCGTACGCCTCAAACTGCAACAGGTGACCAACGCCCCCGACCCGCAGGAAATGACGCAA
CAGCTGGCACAGACGGTACTGCAGGGCAAAACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAA
TCGCCGCCAGTCTGGGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAGCAGTC
GTGGCGGCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCAC
TGGAATCAGGACTTCGCTGGTCGCTACCCGTTCAAAGCCTCACAGAACGATGCCTCCCTCCCCCTGCTGG
CGCAGTATCTGCGCGATGACGGGCGCATCAACCAGTTTATTGCCGCCAACCTTTCCGGCGTTCTGAAACG
TGAAGGCCGCTACTGGGTGGCGGACGCCATGAACACGCAGGGGCTGACGGTCAACCCGGACTTTATCCGC
GCCCTGAACCGCCTGCGCGACGTGGCTGACACCGCCTTTGCCAGCGGCGATGCCGGAATACATTTTGAAC
TGCGGGCAAAACCGGCCCGAGACGTGATGAAGACACATCTGGTGATTGACGGGCAGGAACTGGAGTATTT
CAACCAGAAAGAACGCTGGCAGCGTTTCAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGC
TGGACCAGTACGCAGGCGATGGAACGCATACTGGCGGATTACCGGGGGAGCTGGAGCCTTATTCGCCTGC
TGGAACAGGCGCAGGTGACACCGGTGGACAGCAGCACCTTTAAAGTGGTGTGGAAAGCGCAGGACGGCCT
GCCGCTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGCGCTGCTGGAACTGAAAAACTTC
CGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATGAAAGATGCGGAAGAATACGGGGAAGACGCCG
ATGAGTGA
 Primer design