SecReT6
Protein ID: 386612379
SecReT6 ID631
T6SS typei1
Gene symbol-
Locus tagUMNK88_228
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]244401..247301 [-]
Producttype VI secretion protein IcmFhypothetical protein
NoteTssM
UniProt IDF4M3K8
KEGG IDeun:UMNK88_228
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.90E-85, Aligned region: 115..156
IcmF-related [PF06761], Evalue: 3.90E-85, Aligned region: 297..610
ImcF-related_N [PF14331], Evalue: 1.60E-57, Aligned region: 7..247
DUF1215 [PF06744], Evalue: 7.40E-34, Aligned region: 96..114
DUF1215 [PF06744], Evalue: 7.40E-34, Aligned region: 706..825
Protein Sequence: 966 a.a.     [Download]
>gi|386612379|ref|YP_006132045.1| type VI secretion protein IcmFhypothetical protein, partial [Escherichia coli UMNK88]
MGTCPRLAERKARQPLNGIILTLDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLL
QGFAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRTSLFSFS
RQMQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAP
YFTRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FMDVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPS
LFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYAL
AHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFD
QVFTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYIS
DYTATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEP
DYQLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSD
PIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDAS
LDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSF
AVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQ
FRLFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 2901 bp     [Download]
>gi|386612163|ref|NC_017641.1|:c247301-244401 Escherichia coli UMNK88 chromosome, complete genome
GTGGGAACATGCCCTCGGCTGGCTGAAAGAAAAGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCG
ATTTACCCGATCTGCTTACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTT
GCAGGATATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTCACCCGGCTTGATTTATTG
CAGGGTTTTGCCGCCCTGTTCCAGTCACTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCA
CCCGCCGCGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCG
AATGAATCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCACGTCTTTATTCAGTTTTTCC
CGCCAGATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAATATGA
ACGTGATGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGGCAGATGGATGATATATTCACCCA
GTCTGCCGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCT
TATTTCACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGCGCCT
GGCTGATACGTTCCCGTCGCCGCCTGACAGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTTCTGCTCAT
CACCGGCTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCC
TTTATGGACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTTCTGAACCCGG
TACGCGATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCA
GGGACGACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCG
CTGTTTAACGGGCTGGTCAAAGCGATGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGC
GCGTAATGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACG
CTGGAGCGAAAAATTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTG
GCTCATACTGACTGGCATGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATG
ACAAGCCCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCT
GAAAACGCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGAC
CAGGTGTTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAA
GCTATTTTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTAC
CCGCAGCGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATATCAGC
GACTACACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAAC
TGACCGGGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTCCTGCGTGA
CAACACACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAGCGGGAGGAAGCCCTGGCAGAGCCG
GATTACCAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAG
ACAAAGAAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCA
GAACGCGCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGAT
CCGATATTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGA
CTGACCAGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACAGCGT
GGTGAAACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCA
CTGGATGCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGC
TGTTTATCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGC
GCAACTGGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTT
GCCGTGGAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCG
ATTACAGCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAG
TAAGCTGACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAG
TTCCGCCTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGG
ACGGTGGCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAG
CCAGTTTGGTCTGTCAGACACACTGTACTGA
 Primer design