SecReT6
Protein ID: 386612380
SecReT6 ID631
T6SS typei1
Gene symbol-
Locus tagUMNK88_229
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]247253..247861 [-]
Producttype VI secretion protein IcmFhypothetical protein
NoteTssM
UniProt IDF4M3K9
KEGG IDeun:UMNK88_229
PDB IDNA
Domain hit(s) vs Pfam DUF3366 [PF11846], Evalue: 0.0038, Aligned region: 9..87
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 66..103
AAA_16 [PF13191], Evalue: 0.0039, Aligned region: 117..135
AAA_22 [PF13401], Evalue: 0.0064, Aligned region: 120..162
Protein Sequence: 202 a.a.     [Download]
>gi|386612380|ref|YP_006132046.1| type VI secretion protein IcmFhypothetical protein, partial [Escherichia coli UMNK88]
MPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIALMWLTVRVMKRLQQL
EKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRYLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSD
IIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRASR
 
Nucleotide Sequence: 609 bp     [Download]
>gi|386612163|ref|NC_017641.1|:c247861-247253 Escherichia coli UMNK88 chromosome, complete genome
ATGCCCCGGTTTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCT
GGTGGAAAGGCCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGC
AACGGCGGCGTGGGGGATTATTGCCCTGATGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTT
GAAAAAATGCAAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGC
GTTATCTTGACCGCTGGCTGCTGCGCCTGCAACGCTATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCC
GTGGTATATGGTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGAC
ATTATTTATGCCCCGGAGGGCGCGCGCGGCGCAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAAC
AGGCGGTGATCTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCT
GTGGGAACATGCCCTCGGCTGGCTGAAAGAAAAGCGCGCCAGCCGCTGA
 Primer design