SecReT6
Protein ID: 386620397
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2867
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2932080..2935478 [+]
Producthypothetical protein
NoteTssM
UniProt IDG0DAN3
KEGG IDena:ECNA114_2867
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.20E-61, Aligned region: 393..737
IcmF-related [PF06761], Evalue: 2.20E-61, Aligned region: 797..841
DUF1215 [PF06744], Evalue: 2.10E-29, Aligned region: 427..460
DUF1215 [PF06744], Evalue: 2.10E-29, Aligned region: 859..974
Protein Sequence: 1132 a.a.     [Download]
>gi|386620397|ref|YP_006139977.1| hypothetical protein ECNA114_2867 [Escherichia coli NA114]
MTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGVVFLIIMGVYHLLNRHAAVQNFELRRQLAA
GDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWRRKIRLLLVTGEPEQAEAIAPGLTGQHWLEGDHTVL
IYGGRPSAEPDVALLTALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRELINGGKRLGFQAPFYLWQV
CDNGDYQSGRVLQSVGCLLPEGCTPEQLAAMLEAQTLPLTEQGMSQLLTDNRHDFLLRLAHTLAERGITH
WQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGITGDNARGRAVGFPWLRTALMSA
VCVLAIGGAGMTTSFFANRALVQETSIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWYQRF
GPERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMTSRPE
KADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLRIFMKGDHSITSMLLTDLLHGNTQLLTFWMANLPEH
PQWKTSPPPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPG
MFTRQAWEGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIR
WKKEDSLSGILDQLTLMADARQSPLIALTDTIAWQVATGRENRGLSDSLAKSAQELFNGKEKTPQQSREG
DVPAGPLDKTFAPLLRLLGDKSGGGGGDTQLNLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQG
KTVDLTDTRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLKRAIVSHWNQDFAGRYPFKA
SQNDASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAF
ASGDAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILAD
YRGSWSLIRLLERAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSM
KDAEEYGEDADE
 
Nucleotide Sequence: 3399 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2932080-2935478 Escherichia coli NA114 chromosome, complete genome
ATGACCGTGGCTGTTGTGGTTGCGCTTTGCACGTTTATTCACCGTAAACCGGCATTGCTGGGCGTTGAAC
CGGGTAGCTCACAGCAAATGTACTGGATGGCTGGCGTGATTGCCGCAGGCGTGGTCTTTCTGATTATCAT
GGGGGTTTATCATCTGCTGAACCGCCACGCTGCCGTGCAGAACTTTGAACTCCGCAGACAGCTTGCCGCC
GGAGATGACTATCGTGCGGTGACGACAAAGAAAGCCGACAGCCGTCATCCGGCAATGGTGGAACTCGCCG
CCTTCCTGCGCGACCGCTACGGCCCATTCTGGCGGCGTAAAATCCGCCTGCTGCTGGTGACCGGCGAGCC
TGAACAGGCAGAGGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAGGGCGACCACACGGTGCTG
ATATACGGCGGCAGGCCATCAGCGGAGCCTGATGTCGCGCTACTGACCGCCTTAAAAAAACTGCGCCGCA
GCCGTCCGCTGGACGGCATCATCTGGCCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAA
AGGCTGGCGCGAACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCCCCATTCTATTTGTGGCAGGTC
TGTGACAACGGTGATTATCAGTCCGGGCGCGTCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAAGGCTGTA
CCCCGGAACAACTGGCTGCAATGCTGGAAGCACAGACCCTACCGCTGACGGAACAGGGCATGTCGCAGCT
GCTGACCGATAACCGCCATGATTTTCTGCTGCGTCTGGCCCATACCCTTGCAGAGCGGGGTATCACCCAC
TGGCAGACCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCGGCCTGATGT
TCAGCCCGCCGCTTGCCGCCGTACCGGAGGCCGCACCTCATGCGTGGCTGCCGTCGCCGGTCTGGGCAGG
CATCACCGGCGATAACGCGCGGGGCCGCGCGGTGGGCTTTCCGTGGCTGCGTACCGCACTGATGTCCGCT
GTCTGCGTGCTGGCGATAGGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCACTTGTTCAGG
AAACCAGCATCCAGACGGCGCGGGCGCTCGATACCCGCCTGCCGCTGGCAGAACAACTGGTGGCGCTGCA
TACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTT
GGCCCTGAACGTAACCAGCAACTGCTCGCCGCCGCCTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGG
TGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCC
TCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAA
AAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCAGACGGCCTGCGCTATGAAAATATCCCGGAAG
GCGTGCGGCAGAGCGTGTTGCCGTCACTGCTGCGTATTTTCATGAAAGGAGATCACTCAATAACTTCCAT
GTTACTCACCGATCTCCTTCACGGTAATACGCAACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACAC
CCGCAGTGGAAAACCTCACCGCCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATTG
GTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATAT
GACGCTGGCGGACATGACCGGGGATACCCTCACTGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGG
ATGTTCACCCGTCAGGCATGGGAAGGACAGGTCAGGGAAGCTATCGAGCAGGTGGTGACGGCGCGGCGCG
AGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCTGATATCTCGCCGGATACGCTGCG
TAACCGCCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCGC
TGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACGCTGATGGCCGATGCCCGTCAGTCGC
CACTGATTGCACTGACAGACACTATTGCGTGGCAGGTGGCAACAGGCAGGGAAAATCGTGGCCTGTCAGA
CTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGGC
GACGTGCCTGCCGGGCCGCTGGATAAAACCTTCGCGCCGCTGCTGCGGTTGCTGGGCGATAAGTCAGGAG
GCGGTGGTGGTGATACGCAACTCAACCTGCAAACGTATCTGACCCGCGTCACCCGCGTACGCCTCAAACT
GCAACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGACGGTTTTACAGGGC
AAAACCGTTGACCTCACCGACACCCGCGACTACGGGCGGTTAATCGCCGCCAGTCTGGGCGAAGAATGGA
GTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAACAGTCGTGGCGGCAGGTGCTGACGCCCGCAGC
GGACAGCCTGAAACGGGCGATTGTCAGTCACTGGAATCAGGACTTCGCTGGCCGCTATCCGTTCAAAGCC
TCACAGAACGATGCCTCTCTTCCCTTGCTGGCGCAGTACCTGCGCGATGACGGACGCATCAACCAGTTTA
TCGCCGCCAACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCTGACGCCATGAACACGCA
GGGGCTGACGGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGATGTGGCCGATACCGCCTTT
GCCAGCGGCGATGCCGGAATACATTTCGAACTGCGGGCAAAACCGGCGCGTGACGTGATGAAAACGCATC
TGGTGATTGACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGTTTTAACTGGCCGGA
TGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGCACACAGGCGATGGAACGCATACTGGCGGAT
TACCGGGGAAGCTGGAGCCTTATTCGCCTGCTGGAACGGGCGCAGGTAACACCGGTCGACAGCAGCACCT
TTAAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCACTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGG
GCCGCTGGCGCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATG
AAGGATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design