SecReT6
Protein ID: 386630566
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3119
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3127890..3131063 [+]
Producthypothetical protein
NoteTssM
UniProt IDG7R6Q5
KEGG IDeld:i02_3119
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.10E-66, Aligned region: 341..659
IcmF-related [PF06761], Evalue: 6.10E-66, Aligned region: 721..760
DUF1215 [PF06744], Evalue: 8.90E-35, Aligned region: 375..408
DUF1215 [PF06744], Evalue: 8.90E-35, Aligned region: 780..899
Protein Sequence: 1057 a.a.     [Download]
>gi|386630566|ref|YP_006150286.1| hypothetical protein i02_3119 [Escherichia coli str. 'clone D i2']
MCIFFLFSFRQNEASTISLYAQPTDIKEINTEQPNYASLLTIYLRDRYGPFWRRKVRLLLVTGEPEQAEA
IAPGLTGQHWLEGDHTVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRGL
INGGKRLGFQAPLYLWQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLTDNR
HDFLLRLAHTLAERGIAHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDN
ARGRTVGFPWLRTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGE
LERLQYRIRESAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTAT
GEQRYKQLKALLMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPP
PELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWE
GQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIHWKKEDSLS
GILDQLTLMADARQSPLIALTDTLAWQAATGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDDVPVGPL
DKTFTPLLRLLGDKAGGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTR
DYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDA
SLPLLAQYLRDDGRINLFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDA
GIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSW
SLIRLLEQAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGKSMKDVEE
YGEDADE
 
Nucleotide Sequence: 3174 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3127890-3131063 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGTGCATATTTTTCCTCTTTTCTTTCCGGCAGAACGAAGCCTCGACGATATCACTATACGCTCAACCGA
CTGATATAAAGGAAATAAATACGGAGCAGCCGAACTATGCATCACTGCTGACGATATATTTACGCGACCG
CTACGGTCCGTTCTGGCGGCGTAAAGTCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAAGCC
ATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAAGGCGACCACACGGTGCTGATATATGGCGGCAGGC
CAACAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGG
CATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAAAGGCTGGCGCGGACTG
ATAAACGGCGGTAAGCGACTCGGTTTTCAGGCTCCACTCTATTTGTGGCAGGTCTGTGACGACGGTGATT
ATCAGACCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGTACCCCGGAACAACTGGC
TGTAATGCTGGAAGCACAAACCCTGCCGCTGACGGAACAGGGCATGTCGCAGCTACTGACCGATAACCGC
CATGATTTTCTGCTGCGTCTGGCTCATACCCTTGCAGAGCGGGGTATTGCTCACTGGCAGACCGTCCTGA
AACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCGGCCTGATGTTCAGCCCGCCGCTTGC
CGCCGTGCCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACCGGTCTGGGCGGGCGTGACGGGTGATAAC
GCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTGCGTACCGCACTGATGTCCGCTGTCTGCGTGCTGGTGA
TATGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCTCTTGTTCAGGAAACCGGTATCCAGAC
GGCACGTGCGCTTGATACCCGCCTGCCGCTGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAA
CTGGAACGCCTGCAATATCGTATCCGCGAAAGTGCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTAACC
AACAACTGCTCGCCGCCGCTTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGT
TGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCCTCAGCGTACCGCCACC
GGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCT
TTTTCAGTACCACGCTGATGGCGGACGGTCTGCGCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGT
GTTGCCGTCACTGCTGACCTTCTGGACGGCGAACCTGCCGGAACACCCGCAGTGGAAAACATCGCCGCCA
CCGGAACTGACCGGCGCAGTGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACCC
TCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGGGGA
TACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAA
GGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTACTCAGCG
ACCGCCAGCAGGATACCTCTGCGGATATCTCGCCGGATACGCTGCGTAACCGTCTCACCTCACGCTACTT
TACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCACTGGAAAAAGGAAGACTCGCTCTCC
GGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCGCCACTGATTGCGCTGACGGACACCC
TCGCGTGGCAGGCGGCGACAGGCAGGGAAAACCGTGGTCTGTCAGACTCGCTGGCGAAATCGGCACAGGA
ACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGGTGACGACGTGCCTGTCGGGCCGCTG
GATAAAACCTTCACGCCGCTGCTGCGTTTGCTGGGCGATAAGGCCGGAGGCGGCGACAGCCAGCTGAGTC
TACAGACCTACCTCACCCGCGTCACCCGCGTGCGCCTCAAACTGCAACAGGTGACCAACGCCCCCGACCC
GCAGGAGATGACCCAACAACTGGCGCAGACGGTCTTACAGGGTAAAACCGTTGACCTCACCGACACCCGC
GACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAAGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTTC
GCCCGGTAGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACCGCCAGTGGCAGCG
GGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGCCGCTATCCGTTCAAAGCCTCACAGAACGATGCC
TCCCTCCCCCTGCTGGCGCAGTACCTGCGCGATGACGGGCGCATCAACCTGTTTATCGCCGCCAACCTTT
CCGGCGTGCTGAAACGAGAGGGCCGCTACTGGGTGGCTGACGCCATGAACACGCAGGGGCTGACGGTCAA
TCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCCGATACCGCCTTTGCCAGCGGCGATGCC
GGGATACATTTTGAACTGCGGGCAAAACCGGCGCGTGACGTGATGAAGACGCATCTGGTGATTGACGGGC
AGGAGCTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTTTTAACTGGCCGGATGAACAGTGGCAACC
CGGCGCATCGCTAAGCTGGACCAGCACACAGGCGATGGAGCGCATACTGGCGGATTACCGGGGAAGCTGG
AGTCTTATTCGCCTGCTGGAACAGGCGCAGGTGACGCCGGTGGACAGCAGCACCTTTAAGGTGGTGTGGA
AAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTACGGGTTGAACAGGGTAAAGGGCCGCTGGCGCTGCT
GGAGCTGAAAAACTTCCGCCTGCCGGGACAGGTGTTTCTGACCGGAAAAAGTATGAAGGATGTGGAAGAG
TATGGGGAAGACGCCGATGAGTGA
 Primer design