SecReT6
Protein ID: 386640306
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31010
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3161246..3164584 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDE1P9Q7
KEGG IDeab:ECABU_c31010
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.90E-66, Aligned region: 396..714
IcmF-related [PF06761], Evalue: 3.90E-66, Aligned region: 776..815
DUF1215 [PF06744], Evalue: 1.00E-34, Aligned region: 430..463
DUF1215 [PF06744], Evalue: 1.00E-34, Aligned region: 835..954
DUF4131 [PF13567], Evalue: 0.0084, Aligned region: 8..81
Protein Sequence: 1112 a.a.     [Download]
>gi|386640306|ref|YP_006107104.1| IcmF-like protein [Escherichia coli ABU 83972]
MKRVVRLLGVGLLLLVVLLLILFVLAQTTPLISAQDEHAVWLRLLITAIVICLLSMCIFFLFSFRQNEAS
TISLYAQPTDIKEINTEQPNYASLLTIYLRDRYGPFWRRKVRLLLVTGEPEQAEAIAPGLTGQHWLEGDH
TVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRGLINGGKRLGFQAPLYL
WQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLTDNRHDFLLRLAHTLAERG
IAHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNARGRTVGFPWLRTAL
MSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWY
QRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMTS
RPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKILLRQI
GVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARR
EEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIHWKKEDSLSGILDQLTLMADARQS
PLIALTDTLAWQAATGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDDVPVGPLDKTFTPLLRLLGDKA
GGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWS
GFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRI
NLFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVM
KTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVD
SSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGKSMKDVEEYGEDADE
 
Nucleotide Sequence: 3339 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3161246-3164584 Escherichia coli ABU 83972 chromosome, complete genome
ATGAAAAGAGTTGTGCGTCTTTTGGGTGTGGGGTTACTGCTCCTTGTTGTGTTGTTGCTCATTTTGTTTG
TTCTGGCTCAGACCACACCGCTGATATCAGCACAGGATGAGCATGCTGTCTGGCTTCGTCTGTTGATAAC
AGCGATTGTGATCTGTTTGCTAAGTATGTGCATATTTTTCCTCTTTTCTTTCCGGCAGAACGAAGCCTCG
ACGATATCACTATACGCTCAACCGACTGATATAAAGGAAATAAATACGGAGCAGCCGAACTATGCATCAC
TGCTGACGATATATTTACGCGACCGCTACGGTCCGTTCTGGCGGCGTAAAGTCCGCCTGCTGCTGGTGAC
CGGCGAGCCTGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAAGGCGACCAC
ACGGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAAC
TGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCA
ACTCGACAAAGGCTGGCGCGGACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCTCCACTCTATTTG
TGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGG
AACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGACGGAACAGGGCAT
GTCGCAGCTACTGACCGATAACCGCCATGATTTTCTGCTGCGTCTGGCTCATACCCTTGCAGAGCGGGGT
ATTGCTCACTGGCAGACCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCG
GCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACCGGT
CTGGGCGGGCGTGACGGGTGATAACGCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTGCGTACCGCACTG
ATGTCCGCTGTCTGCGTGCTGGTGATATGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCTC
TTGTTCAGGAAACCGGTATCCAGACGGCACGTGCGCTTGATACCCGCCTGCCGCTGGCAGAACAACTGGT
GGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATATCGTATCCGCGAAGGTGCGCCGTGGTAT
CAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCTTTTCCCGGCTATGCGCAGGCGGCAA
ACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCC
CAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCC
CGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCGGACGGTCTGCGCTACGAGAATA
TCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACCTTCTGGACGGCGAACCTGCCGGAACA
CCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAGTGCGTAAAATCCTGCTGCGCCAGATT
GGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATA
TGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGG
GATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGC
GAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGCCGGATACGCTGC
GTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCA
CTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCG
CCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGACAGGCAGGGAAAACCGTGGTCTGTCAG
ACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGG
TGACGACGTGCCTGTCGGGCCGCTGGATAAAACCTTCACGCCGCTGCTGCGTTTGCTGGGCGATAAGGCC
GGAGGCGGCGACAGCCAGCTGAGTCTACAGACCTACCTCACCCGCGTCACCCGCGTGCGCCTCAAACTGC
AACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAACAACTGGCGCAGACGGTCTTACAGGGTAA
AACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAAGAATGGAGT
GGCTTCGGTCAGGCGCTGTTCGTTCGCCCGGTAGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGG
ACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGCCGCTATCC
GTTCAAAGCCTCACAGAACGATGCCTCCCTCCCCCTGCTGGCGCAGTACCTGCGCGATGACGGGCGCATC
AACCTGTTTATCGCCGCCAACCTTTCCGGCGTGCTGAAACGAGAGGGCCGCTACTGGGTGGCTGACGCCA
TGAACACGCAGGGGCTGACGGTCAATCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCCGA
TACCGCCTTTGCCAGCGGCGATGCCGGGATACATTTTGAACTGCGGGCAAAACCGGCGCGTGACGTGATG
AAGACGCATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTTTTA
ACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTAAGCTGGACCAGCACACAGGCGATGGAGCGCAT
ACTGGCGGATTACCGGGGAAGCTGGAGTCTTATTCGCCTGCTGGAACAGGCGCAGGTGACGCCGGTGGAC
AGCAGCACCTTTAAGGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTACGGGTTGAAC
AGGGTAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACAGGTGTTTCTGACCGG
AAAAAGTATGAAGGATGTGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design