SecReT6
Protein ID: 386707944
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01050
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]242268..245732 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDH9XXH7
KEGG IDell:WFL_01050
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.10E-84, Aligned region: 303..344
IcmF-related [PF06761], Evalue: 6.10E-84, Aligned region: 485..798
ImcF-related_N [PF14331], Evalue: 2.40E-62, Aligned region: 185..435
DUF1215 [PF06744], Evalue: 3.90E-34, Aligned region: 284..302
DUF1215 [PF06744], Evalue: 3.90E-34, Aligned region: 894..1013
AAA_22 [PF13401], Evalue: 9.00E-05, Aligned region: 120..253
AAA_22 [PF13401], Evalue: 9.00E-05, Aligned region: 836..867
Protein Sequence: 1154 a.a.     [Download]
>gi|386707944|ref|YP_006171665.1| IcmF-like protein [Escherichia coli W]
MPRFKVSAFWLLILAWIFLLVWIWWKGPMWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQQL
EKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSD
IIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILT
LDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVT
FTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESR
AWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDFGNLQLPLLN
PVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAV
LRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTP
YDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGL
QSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNIRNFESIG
QLTGALEQVISGDLPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDYQLLTRLGHEFAPENSTLAVQ
KDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGR
LADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNL
KLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQL
VDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFS
VDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|386707734|ref|NC_017664.1|:c245732-242268 Escherichia coli W chromosome, complete genome
ATGCCCCGGTTTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCT
GGTGGAAAGGCCCGATGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGC
AACGGCGGCGTGGGGGATTATTGCCCTGGTGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTT
GAAAAAATGCAAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGC
GTTATCTTGACCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCC
GTGGTATATGGTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGAC
ATTATTTATGCCCCGGAGGGCGCACGCGGCGCAGAACAACGCCTGTACCTCACGCCCCATGTCGGTAAAC
AGGCGGTGATCTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCT
GTGGGAACATGCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACA
CTCGATTTACCCGATCTGCTTACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGACGCTGCGCAGCC
GCTTACAGGATATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTT
ATTACAGGGTTTTGCCGCCCTGTTCCAGTCACTCAACAGACAGGATCGCGATGCGATTCTGGGCGTCACG
TTCACCCGCCGTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGG
ATCGAATGAATCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTT
TTCCCGCCAGATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAAT
ATGAACGTGATGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGACAGATGGATGATATATTCA
CCCAGTCTGCCGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGC
GCCTTATTTCACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGC
GCCTGGCTGATACGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTGCTGC
TCATCACCGGCTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAA
AGCCTTTATGGACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTCCTGAAC
CCGGTACGCGATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGT
ACCAGGGACGACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCC
CTCGCTGTTTAACGGGCTGGTCAAAGCGATGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTG
CTGCGCGTAATGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAA
AACGCTGGAGCGAAAAATTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGC
GCTGGCTCATACTGACTGGCATGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCA
TATGACAAGCCCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGA
GCCTGAAAACGCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTT
TGACCAGGTGTTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTG
CAAAGCTATTTTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACC
TTACCCGCAGCGTGAAATACAGTGACGCCGACCGTGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATAT
CAGCGACTACACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGA
CAACTGACCGGGGCGCTGGAGCAGGTTATCAGCGGCGACCTGCCTTTGCAGCGGGCGCTAACCGTGCTGC
GTGACAACACACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGA
GCCGGATTACCAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAG
AAAGACAAAGAAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAA
TCCAGAACGCGCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAG
CGATCCGATATTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGG
CTGGCTGACCAGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACA
GCGTGGTGAAACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGC
CTCACTGGATGCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTG
AAGCTGTTTATCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTA
TTGCGCAACTGGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATC
CTTTGCCGTGGAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTA
GTCGATTACAGCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACG
AAAGTAAGCTGACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGC
GCAGTTCCGCCTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGC
GTGGACGGTGGCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGT
TCAGCCAGTTTGGTCTGTCAGACACACTGTACTGA
 Primer design