SecReT6
Protein ID: 386743279
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09535
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2039811..2042579 [-]
Producthypothetical protein
NoteTssM
UniProt IDI0DTU9
KEGG IDpsi:S70_09535
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.50E-83, Aligned region: 254..569
ImcF-related_N [PF14331], Evalue: 1.50E-50, Aligned region: 2..207
ImcF-related_N [PF14331], Evalue: 1.50E-50, Aligned region: 578..625
ImcF-related_N [PF14331], Evalue: 1.50E-50, Aligned region: 651..679
DUF1215 [PF06744], Evalue: 4.70E-36, Aligned region: 29..70
DUF1215 [PF06744], Evalue: 4.70E-36, Aligned region: 367..402
DUF1215 [PF06744], Evalue: 4.70E-36, Aligned region: 496..523
DUF1215 [PF06744], Evalue: 4.70E-36, Aligned region: 661..780
Protein Sequence: 922 a.a.     [Download]
>gi|386743279|ref|YP_006216458.1| hypothetical protein S70_09535 [Providencia stuartii MRSN 2154]
MRIEEVRMTFNSQLPLYIVLTKLDLLRGFDAMFQSLDAQQRNQVLGVSFSSKENVNWEKQLNHFWSQWVS
QMNSALPEMMLNRSEGSQRSDLFSFVRQIEGLQSSVAKLISALVANNEQKNIRLRGVYLTSATQVGQIDD
VFSQTASVQYHLPTAPLTTWPISDTHPYFTHNLFSDVLFSEPNLAAENHYWLKKHRTRLLVASTVSIVGL
ILAWNGWSHYYNKNYRAGENVLNEVKAFKAIESTTTKDTDGSKQLPVLNPLREATLAYGNHRDKNGILSE
MGLYQGQKVGPQVENVYLQLLTERFLPAIMAGLLIELDNAEKGSEEKLEILRVMRMLEDKSGRNNGLVED
YMANYWSQLFTGQRDIQAQLRGHLHYALEHTDWKAERNQGSAIANKVFGPFAKPISDAQKELSTLSLYQR
VYQTLRLKANQTLSSPLNLRHQIGPGFNSVFTVNDEDKLEIPQFLTRSGLINYFIRQNDELVDLTLLDAW
VLNLSSNTQYSESDRKEIQRQISEQYLNDYTAQWRGAMSNLEIREFDTIQDEINALEQIISGEQPLRRAL
QVLRDNTSLPTIDSSLSSQEQQKLMAEPKYRLLSRLDREFSPETEILVSNNGENLQNLNQKLNELHRYLL
SIQNSPVPGKAALKAVSMRLNDNNRDVIFELSQMAKTLPEPLNRWVGDLSDQAWNVVQKEAIRYMEVEWN
ENVVKQYNAYIAGRYPFNPKSKQDVPLSEFERFFKPNGTIDSFYQQNLRLFVENNLIENMEGQSLIRPDV
LEQIEIANRIRDTFFTAQGNLETQFAVEPLSLSGNKRRSILNLDGQIIDYSHGRSNTVHMVWPNSMRSNI
ESKLTLVPLSGDKSPRSLSFSGPWAQLRLIDSGRLMNVKPNSFEVRFTIDGGDMTYRVQIDESNNPFFGG
LFTRFRLPETLY
 
Nucleotide Sequence: 2769 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2042579-2039811 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGCGTATTGAAGAAGTCCGTATGACATTCAATAGTCAATTACCACTCTATATTGTGTTGACTAAACTGG
ACTTGTTACGTGGTTTTGATGCGATGTTCCAATCCCTTGATGCTCAACAGCGTAATCAGGTATTAGGGGT
ATCTTTTAGCTCAAAAGAAAATGTTAATTGGGAAAAACAGCTCAATCACTTTTGGAGCCAATGGGTTAGC
CAAATGAACAGTGCTTTACCTGAAATGATGTTAAATCGTTCAGAAGGAAGCCAAAGAAGCGACTTATTTA
GTTTTGTTCGCCAAATTGAAGGGTTACAAAGCAGTGTAGCAAAATTAATCTCTGCATTGGTTGCTAACAA
TGAACAGAAAAATATCCGTTTAAGAGGGGTTTATCTCACCTCTGCGACTCAAGTTGGTCAGATTGACGAC
GTCTTTAGCCAAACGGCGTCAGTTCAATACCATTTACCAACAGCACCACTAACAACTTGGCCTATTTCAG
ATACACATCCCTATTTTACGCACAACTTATTCAGTGATGTGCTGTTTAGCGAGCCAAACTTAGCAGCGGA
AAACCATTATTGGCTGAAAAAACATCGTACCAGACTTTTAGTTGCTTCAACTGTCAGCATTGTTGGTTTG
ATATTGGCTTGGAATGGCTGGAGCCATTACTACAACAAAAACTATCGTGCGGGCGAGAATGTGCTTAATG
AAGTTAAAGCATTTAAAGCGATTGAATCAACGACAACTAAAGATACTGACGGTAGCAAACAACTTCCTGT
TTTGAACCCACTTAGAGAAGCAACATTAGCTTACGGAAACCATCGTGATAAAAATGGCATTCTGTCTGAA
ATGGGGTTATATCAGGGGCAAAAAGTTGGACCACAAGTTGAAAATGTCTACTTGCAATTGTTAACGGAAC
GCTTTTTACCCGCCATTATGGCAGGGTTACTTATTGAGCTGGATAATGCTGAAAAAGGCAGTGAAGAGAA
GCTCGAAATCTTACGTGTTATGCGCATGCTTGAAGATAAAAGTGGGCGTAATAACGGGTTGGTTGAAGAT
TATATGGCAAACTACTGGAGCCAGCTATTTACAGGGCAACGAGATATCCAAGCTCAGCTTCGCGGCCATT
TACATTATGCGTTAGAGCACACTGACTGGAAAGCTGAGCGTAATCAAGGTTCAGCGATTGCCAATAAAGT
CTTTGGGCCATTTGCCAAACCAATCAGTGACGCTCAAAAAGAGCTGAGCACGCTGTCGCTATACCAACGT
GTTTATCAAACACTGAGGCTGAAAGCGAATCAAACACTGTCATCACCATTAAACCTCCGTCATCAAATAG
GCCCTGGTTTTAACTCAGTGTTTACTGTGAACGATGAAGATAAGCTCGAAATCCCTCAGTTTCTCACCCG
TTCTGGGCTGATTAACTACTTTATTAGGCAAAATGATGAATTGGTCGATCTGACATTACTTGATGCTTGG
GTGCTAAATTTATCAAGCAATACACAGTATAGCGAGAGTGACCGTAAAGAGATCCAACGTCAAATTAGCG
AACAATATCTGAATGACTATACTGCGCAATGGCGTGGAGCGATGAGTAATTTAGAGATTCGTGAATTTGA
CACAATTCAAGATGAAATCAATGCATTAGAACAGATAATCAGTGGTGAGCAGCCGTTAAGACGTGCATTA
CAGGTACTGAGAGATAACACTTCTTTACCTACCATTGATAGTTCGCTGTCTTCACAAGAGCAGCAAAAAT
TGATGGCAGAGCCGAAATACAGGTTGCTTAGCAGGCTGGATAGAGAGTTTTCACCTGAAACTGAGATCTT
AGTGAGTAACAATGGTGAAAACCTACAAAATCTCAATCAGAAGCTAAATGAATTGCATCGTTATTTATTA
AGTATTCAAAACTCACCAGTACCAGGTAAAGCTGCACTAAAAGCGGTGTCTATGCGTTTGAATGATAATA
ACCGTGATGTCATTTTTGAGCTATCACAAATGGCGAAAACATTACCAGAACCATTAAATCGTTGGGTAGG
AGACCTCTCGGACCAAGCATGGAATGTGGTACAAAAAGAAGCTATTCGTTATATGGAAGTCGAGTGGAAT
GAAAACGTTGTCAAACAGTACAACGCGTACATCGCTGGACGTTATCCATTTAATCCGAAATCTAAACAAG
ATGTGCCATTAAGCGAATTTGAACGTTTCTTCAAACCAAATGGCACCATCGATAGTTTCTATCAACAGAA
TCTACGTTTATTTGTTGAAAATAACTTGATTGAAAATATGGAAGGCCAATCGCTGATTCGCCCTGATGTA
TTGGAGCAAATTGAGATTGCTAACCGCATTCGAGACACCTTCTTTACTGCTCAAGGTAATCTTGAAACAC
AATTTGCGGTAGAACCGTTGTCACTGTCAGGTAATAAACGTCGCAGTATCTTGAACCTTGATGGGCAGAT
TATTGACTACTCTCATGGGCGCAGTAACACCGTACATATGGTGTGGCCAAACTCAATGCGTTCAAACATT
GAAAGTAAGCTGACATTAGTGCCTCTTTCTGGTGATAAATCCCCTCGTTCGCTCAGCTTTAGCGGACCTT
GGGCGCAATTACGCCTTATCGATAGCGGCAGGTTAATGAATGTGAAACCAAACTCTTTTGAAGTTCGCTT
CACAATTGATGGCGGAGATATGACTTATCGCGTGCAAATTGATGAATCTAACAACCCGTTCTTCGGAGGA
TTATTTACCCGATTCCGTTTACCTGAAACGCTTTATTAA
 Primer design