SecReT6
Protein ID: 386743280
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09540
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2042555..2043358 [-]
Producthypothetical protein
NoteTssM
UniProt IDI0DTV0
KEGG IDpsi:S70_09540
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.10E-10, Aligned region: 210..250
DUF4131 [PF13567], Evalue: 0.0025, Aligned region: 28..95
Protein Sequence: 267 a.a.     [Download]
>gi|386743280|ref|YP_006216459.1| hypothetical protein S70_09540 [Providencia stuartii MRSN 2154]
MKLSFLSIPKITGSLKKLFFGDKPKIKSFLLLCLALLPAILIIWIWWWGPDFNYKGSYPLKELSARWLAT
IIILLIIVSWIGIATWKRVKRLESLKLDVELAVVDPVRHDIEFQNRYLDYWKSQFVRHLNGHTQSVYLRP
WYFVLGADESGKHTLLKNSLNTLDIAPTENVVSDQKLPLHIQCLLADNAVLFVPDGKLLTQPVSEGDKPQ
LYHRLWNELLHWLSKNRSRQPMNGIVLTVDTLSLLTNSKEKIASSLLIYICVLKKSV
 
Nucleotide Sequence: 804 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2043358-2042555 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGAAATTATCTTTTCTATCCATACCAAAAATAACGGGTTCTCTTAAGAAGCTGTTTTTTGGCGATAAGC
CCAAAATTAAATCATTCTTACTGCTGTGTTTGGCACTGCTCCCAGCGATTTTGATTATTTGGATTTGGTG
GTGGGGACCCGATTTTAACTACAAGGGCAGTTATCCCCTTAAAGAGCTGAGCGCGCGTTGGTTAGCGACG
ATTATTATTCTTCTCATCATTGTGAGTTGGATTGGGATCGCGACATGGAAACGTGTAAAACGCCTTGAAA
GCCTTAAATTAGACGTGGAATTAGCGGTTGTTGATCCTGTTCGTCACGATATTGAGTTTCAAAATCGTTA
TCTCGATTATTGGAAATCGCAATTTGTTCGTCACCTCAACGGACATACTCAATCCGTATATTTACGTCCT
TGGTATTTCGTATTGGGGGCCGATGAGAGTGGTAAGCATACATTACTAAAAAATAGCCTTAATACTTTAG
ATATTGCACCAACAGAAAATGTTGTTAGTGACCAGAAACTCCCTCTGCATATTCAATGTCTACTCGCGGA
TAATGCCGTCCTTTTTGTGCCAGATGGGAAATTATTGACCCAGCCAGTGAGTGAGGGGGATAAGCCCCAG
CTATATCATCGTTTATGGAATGAACTTTTACACTGGTTAAGCAAAAACCGTTCAAGACAACCAATGAATG
GCATTGTTTTAACCGTGGATACTTTGTCATTACTGACAAATTCGAAGGAAAAAATAGCCAGCTCATTGCT
GATCTACATATGCGTATTGAAGAAGTCCGTATGA
 Primer design