SecReT6
Protein ID: 386860317
SecReT6 ID642
T6SS typei4b
Gene symboltssM-1
Locus tagBP1026B_I0197
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]190254..194147 [-]
Producttype VI secretion system
NoteTssM
UniProt IDI1WF24
KEGG IDbpz:BP1026B_I0197
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 64..107
ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 189..445
IcmF-related [PF06761], Evalue: 1.60E-53, Aligned region: 494..861
DUF1215 [PF06744], Evalue: 1.90E-28, Aligned region: 993..1108
Protein Sequence: 1297 a.a.     [Download]
>gi|386860317|ref|YP_006273266.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALGVALALWLATKLWRRWRVRRANRQLG
DMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRYRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPAVAQGRQQGGLYNDASPTNVEDAYNALKTYLM
LSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDNDWPMIEANLALVDQTR
ENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRD
AATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVDINGNPADVPM
GPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLK
FVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKVE
AGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSA
AASSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLV
NEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAPQVAVTAASASNAQGAQ
 
Nucleotide Sequence: 3894 bp     [Download]
>gi|386860126|ref|NC_017831.1|:c194147-190254 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGACGCGCTCCAGATCGGCCTCGTATGGGCGGCCGTCGCGCTCGGTGTCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTGGCGCGTGCGCCGCGCGAACCGCCAGCTCGGC
GACATGCTCGAGCAGCAGGCCGAAACGGGCAAGATGTCCGCCGCCGTGGCCGAGCCCGCGAAGCGCGCGG
AGCTCGACGTGCTGCGCACCCGCCTCGCCGACACGGTGAAGACGATCAAGACTTCGAAAATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAATCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGTTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGCATCCTGCTCGACACCGCGGGCCGCTATTC
GGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTTCTCGATCTGCTCAAGCGCTATCGCCCGAAGGCC
CCGATCAACGGCATCATCGTGACGGCGAGCATCGCCGAGCTCACCGGCAATCGCCCCGAATTCGCGATCA
ACCTCGCGAAAAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAGGCCGACCTGATCACGGGCTTCACCGAATTCTTCAGCAGCAACGATCGCCAGGAA
TACGACCGCGTGTGGGGCGCGACGCTGCCGTACGAGCCTGACGAGAAGCGCGACGTGGTCGCGCTGTTCG
ATCAGCGCTTCGAGGAACTGTATGACGGGCTCAAGGAAATCAGCGTCGCGCAGTTGTCGGTGAGCCGCGG
CAACAAGCTCTCGCCCGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTACTTCACGA
GCGCGCTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGCACCGCTTCGGGCTCGATTC
GCAAAGCCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTTTCGAAG
GTGATCTTCGCCGATCGCCAGACGGTCCGCCAGTTCGCGAGCCCGACGAAGACGCGCGTGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGACGATCGGCAACCA
GCAACTCGTCTCGAACGTGCAGGCCGACCTCGACAACGTGACCCGCCTGCAGCAGAACCGCAACGATCTG
CAATCTCGCCTGCAGGCGATGGACATCCTCGAGGATCGGATCGAGCAGCTCGAGCAGTTCCGGCGCGACA
AGCCGCTGTCCGTCTCGCTCGGCCTGTATCAGGGCAATCGGCTCGAGCAGCACCTGTTGACCGAGTACTA
CAACGGCGTGCGGCAGATCCTGCTCGCTCCCGTGTCGGACAATCTCGCGTCGTTCCTGAAGGACGTGAAC
GCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGACGCCGGCGGGCCCGATGC
CGGTATCGACCCATCCCGCGGCGCCGGGCGCGGCCCCCTCCCCCGCCGTCGCGCAGGGCCGGCAGCAGGG
CGGCCTCTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTGATG
CTCTCCGACAAGCGGCACGTCGAGCAGGCGCACCTGACCGATCAGGTCGCGCGCTTCTGGCGCGGCTGGC
TCGAGACGAATCGCGGCAACATGCCGCGCGACGAGATGATCAGGAGCGCGGAGCGAATGATCACGTTCTA
CCTGTCGCGCGTGTCCGACAACGACTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGACCAGACCCGC
GAGAACCTGCGCCGCGTCGTGCGCGGCATGCCGGCCCGCCAGCGCGTGTATGAAGAGATCAAGGCGCGCG
CGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACCGGCCTCGTCGCGGG
CAGCTACGCGATCCCCGGCACGTTCACGCGCGACGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGCGAC
GCCGCGACGAAGGAGCTGCAGGCGAAGGATTGGGTGCTGAACACCGCGTCGGCGGACGATCTGACGCTCG
AGGGCAGCCCCGAGCAGATCCAGAAGACGCTCGTCGCGATGTACAAGACCGAGTACGCGCAGCACTGGCA
GAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAATTTCACGCAGGCGGTCGACGCGATGAACAAG
CTCGGCGATCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACCTCGTGGGACA
ACCCGTCGCTCGCGAACGCGACGATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGTGGTT
CACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCGATG
GGCCCGATCGGCCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCCACGCACGACGGCACGTCGATGCTCA
AGGGCTACATGGACACGCTGTCGAAGGTCCGCACGCGCTTTAACGTGATCAAGAACCAGGGCGACCCCGG
CCCCGGCGCGCGTCAGCTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAG
TTCGTCGACGAGCAGATGCTCACGGGCTTGACCGATTCGCAACGCAAATCGCTGCGCCCGCTTCTCGTGC
GCCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTATGGAACGC
GCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTCGCGGCGGGCGCGAAGGTCGAG
GCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCACGACGC
TCGGCCCGCTCGCGGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGCGACATGGGCCTCGCGCT
CACGCCGGACTTCACGGGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGCGCG
GCCGCGTCGTCCGAGCCGCAGACCGTGTTCCAGGTGCTGCCGCAGCCGAGCAGCGGCACGACCGAATACA
CGATCGCGATCGACGGCCAGCAGCTGCGCTACCGCAACACGCCGCCGCAATGGACGAACTTCGTGTGGCC
GAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGTTGCAGCTCGTC
AACGAGCCGGGCCGCTACGGCCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCA
CGTTCGATCTGACATGGACGCAGGGCAGCGTCAGCGTCTCGGTGACGATGCGCATCATCAGCACCTCGCA
GCCGACGGGCGGCGGCGATCAGCCGCAGCAGCAAAGCCTGCGCGGCCTGCGCCTGCCTTCGTCGGTCGCC
GACGCGAGCGCGGGCGGCGCGGCCAATGCGACGGCGCAACCCGGCTCGGGCGCCGCGGCCCCGCAGGTCG
CCGTCACGGCCGCTTCCGCATCGAACGCACAGGGGGCGCAATGA
 Primer design