SecReT6
Protein ID: 386863844
SecReT6 ID644
T6SS typei3
Gene symboltssM-2
Locus tagBP1026B_II0111
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]123629..127537 [+]
Producttype VI secretion system
NoteTssM
UniProt IDI1WQ50
KEGG IDbpz:BP1026B_II0111
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 393..495
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 3.10E-33, Aligned region: 1036..1159
Protein Sequence: 1302 a.a.     [Download]
>gi|386863844|ref|YP_006276792.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLLRWPL
SPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLYRLWQAVRTNDALLKRILEPS
AGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSG
LKFPLADQMEASSERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRMLGGDAGAQTR
DSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGY
LDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATY
RSLLRRSLLPQIVRRVEDALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADT
GSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLRTV
LGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQK
ALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITEL
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|386863735|ref|NC_017832.1|:123629-127537 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGTCTTACCTGAAACGCTTCTTGAGATTCGTCTTTTCGTGGCAGATGCTCGCATGCATCGCGGTGCTGC
TTGTTTGCGCCGCCGTATGGTTCGTCGGCCCCCTGCTCGCGTTCGACGAGTTGCGGCCGCTCGCGGGCGT
CGTCGTGCGGGTCGCCGTCATCGTCCTTCTCGTGGCGCTCCTTGCGTTCTGGCTGTTGCGCTGGCCGCTC
AGCCCGATCGGCGTCGCCGCACTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGCCCGTTCGGGCCCGCGTGGGTCCGCGTGCTGATCGTCGCCGCGATGCTCTTCTGCTACGCCGTGTA
TGGTCTCTATCGCCTGTGGCAGGCGGTTCGGACGAACGACGCATTGCTCAAGCGCATTCTCGAGCCGTCG
GCGGGCAAGCCGGACGCGGCGGCCCAGGCGAACATCCGTGCGGTGAGCGTGGCGGTGTCGAAGGCGATCG
GTCAACTGAAGCGCTTGCGCGGCGGTGCGTTCGGCTGGCGGCGCTTGCTCGAAAGCGGGCGCTACCTGTA
TGAACTGCCGTGGTACATGGTGGTCGGCGCGCCTGGTGCGGGCAAGAGCGCGGCGATCGCGCGTTCCGGC
CTGAAGTTTCCGCTCGCGGATCAGATGGAGGCATCGTCCGAGCGCGCGCGGGGCGGCACGGCCAATTGCG
AATGGTGGTTCGCCAACGAGGCCGTGTTGATCGACACGGCGGGCCGTTACGTGCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACAGTTGCCAACGGGGCGGAATGGAAGGGCTTTCTCGGTCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAATGGCGTGGTCCTGTCGGTCAGCGTCGAGGAGCTCGTCGGGCGCACGCCGGCCG
AGCGCACCGCGCACGCAGCCACGCTGCGCGCCCGCCTGGGCGAGTTGCATCAGGAACTGGGCATTCATTT
CCCGGTATACGTGATCGTCACGAAACTCGATTTGCTGCCCGGCTTTCCGGAGTATTTCCAGTCGTTGACG
GCCGAAGGGCGGACGCAGATCTGGGGATTCACGCTGCCCTACGACGCGGAGAACAGGCGGAGCGCGGTCG
GCGCGCTGCGCGAGCATTGCGCCGACGAGCTGAAGCGGCTGGAGATGCGTATCGACGCGGGGCTGAACAA
CCGTCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGCGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCGGCCGCGCTGTCGGACATGCTCGCCCTCGTGTTTCTCGATTCACGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTACTTCACGAGCGCCGAGCAGACGGATCAGGTATTGGCCGCGGATCGCGA
AACCATCCTGCAGCGCCTGAAGCGCCAGCTCGGCAGAATGCTCGGCGGCGATGCCGGCGCGCAGACGCGT
GACAGCGGCGCGGTGTCGGGCAGCCGCGGCTACTTCCTGCGCGATGTGTTCCAGCATGTGATCGTGCCGG
AGGCGCATCTGGTTCGGCCGAACGTCAGGTGGGAAGTGCGTTTTCGCCTGATGCGCTGGGCCGGGCATCT
GCTCGCCGTCGCATTGCTGGTCTGGCTGGCGAGCGCGCTGACGGTGAGCTTCGACAACAATCGCGGTTAC
CTGGACGCGATCTCGGAAAAGACAGCCGCGCTCGCCGCACGAGTCAACGCGTACAACAAGGCGCCGAAGC
CGGCGCAGATCGGGGGCGTACTGGATGGCGCGCGCGATCTTCCTCAGCATGGCAATCTCGATCTCGACGC
GCCCGGCGCGAGCTTCCGCTACGGCCTGTATGTCGCACCCGGCATCGTCGACGCGTCCGACGCGACTTAT
CGGAGCCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGCGTCGAAGATGCACTGAGCGCGCAAA
TCGATGCGAAGCATGCGGACGAGGTCTATCGCACGCTGACGGTCTACTTGATGCTCGACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAAGACTGGGTCATGCGCGACTGGGAGCGCTCGGATAGCGCGGCCGAGATG
GGAGGGCGCAATTTGATGGCGCGGCACCTGGACGCGCTGTTCGTCGATGCTCGGCCTTTCGAGCCGAGCG
GGCACCGGAACGCCGCACTCGTTCAGCGCGCCCGACTTTTCCTCAACGCGAATCCGGCCCCGAGGCGGCT
GTACGAGCGTGCGATGGCCGCGATCGAGAAGGAGGCGCCGGAGAACTTCACGCTCGCGCGTGCGGTCGGG
CTTCAGGGCGCGGGCATCTTTCGGCTCGCCGACGGCTCGCGGTTTCAACGCGGGATGCCCGGCTTGTATA
CGTACGATGGCTACCACCAGGTATTCAGCGCCCGGTTGCCCGAATTTCTCGCCCGTGCGCAAAGCGACGA
CGCATGGGTGATGGGGAACGCCGGCCCCGCCGCGCGATGGGGCGACGCGATTCGGAACACGCAGGCCGTT
GCGGGTCGGTCTTCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCAACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGCGTCGTCCGGAGAGGACGGCGCGGGCGGCACGCTCGCATTCGATCT
CGCGACGCTGCGCGCGCTCGCCGCCCCCGATTCACCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGCTGTCGGTCGTCGACGCACGGGAAGACGCGTCGTTGACCGACGCCGCGCTTTCGTCGCTCGGGC
GACGATCCGGCGCGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGGCGGCCGGAGCAGCG
CCTCGAGAAGGAGCTGGTGGACAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGACACG
GGAAGCGGGCCGGCGATGACGGACGTGCCGGTCGCGGCGGGGGGCCGGGCGCTGCAGCTCGACGCGATCC
TCACGCTGATCAACGAACAGTACACGCGCCTCGTCGTTGCCGACAACGCGCTCTCCTCGCAGAGCATGCC
GCCCGCGCTGGACATCGGCACCACCTTGCAAATGGAGGCGGAGAAACTGCCCGCGCCGCTGCGCACGGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAAGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAACGCGTGTCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGCAGCGCGCA
GGAAGTCGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGCCTGTTCGACGCGTTTTTTCAGAAG
GCGCTCGCGCCGCATGTCGACACCCATTCGAAGCCGTGGCGTTACAAGGCGTTGAATCCCGGCATGCCGC
CGATCCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGACGTGTTCTTTCGTGAACC
GGGCGCAAAGCGGATGGCGTGGAGGATGGATGCGAAGGTGGCGTCGATCGACCCTGAGATCACCGAGCTC
ATCGTCGACGTCGACGGCCAGTCGCAGCGCTATGTCCACGGCCCTGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCCGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CGCGACGACGGGGCCCTGGGCGCTGTTTCGGCTGATCGAGCGCGGGCGATTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGTCGGCACGCGGCCCTGGAGCTCAGGACGAACGGCCAGA
TGAATCCGTTGACGAGCGGCTTGCTGACGCATTTTCGCTGTCCGGGGAGCGTCGGTTGA
 Primer design