SecReT6
Protein ID: 386863919
SecReT6 ID645
T6SS typei3
Gene symboltssM-3
Locus tagBP1026B_II0188
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]221152..225228 [-]
Producttype VI secretion system
NoteTssM
UniProt IDI1WQC5
KEGG IDbpz:BP1026B_II0188
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.20E-97, Aligned region: 632..952
ImcF-related_N [PF14331], Evalue: 3.20E-93, Aligned region: 313..585
DUF1215 [PF06744], Evalue: 1.60E-35, Aligned region: 290..316
DUF1215 [PF06744], Evalue: 1.60E-35, Aligned region: 951..979
DUF1215 [PF06744], Evalue: 1.60E-35, Aligned region: 1060..1184
Protein Sequence: 1358 a.a.     [Download]
>gi|386863919|ref|YP_006276867.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLLWLAGRPTSIV
FVALLCVLIWHASPLLAFGGATPFAPEAVRAIAIALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQ
PESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSF
PVAAQMPRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPFDAAADARRA
NGQPAGERHAVAMAAAAPSNAAFVDERLAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTS
ADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQAWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDRVFADSRYDDT
QHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDAR
LVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEA
VPDVLTQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIAD
RDPKAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIR
NDALIRQARAFLDGSNATERLYERAKAAMDKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAF
LGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALG
VRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSM
PPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDS
KRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFG
APGQKQMAWKADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMF
SLADTGAPPGLPPGSPAAPASRVARDGR
 
Nucleotide Sequence: 4077 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c225228-221152 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAACAAGTTCCTGTCCTTTCTGGTGTCTCGATCGTTCATCGCGTTCGTCGCGCTGCTCGCCGTCGCGC
TCGTCATCTGGTTCGTCGGCCCGTTCGTCGCGTTCGGCGGGCTCACGCCGCTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCCGGCCGACGAGCATCGTG
TTCGTCGCGCTGCTGTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCGGCGCGACGCCGT
TCGCGCCGGAGGCGGTCCGGGCGATCGCGATCGCGCTCGTGCTCGCGGCGTTCGCGCTGCACCTTGCGTT
CCGGCTGCTGCAAAAGGCGCGCACCGATCCGGATTTTCTGAAGAGCTTGCTCGAATTCGGCGGCAAGCAG
CCCGAATCGCCCGCGGCCGGCCGCCTGGTGGCGGTCAACGCCGCGATCGCCGGCGCGATCGCGCGCCTGA
AAGGCATGCGCAGCGGCGCGCGCGGCCTGCGCCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCGGGCATGCGGCAAGACGAGTGCGCTCCTGAACGCCGGGCTCTCGTTT
CCGGTCGCGGCGCAAATGCCGCGCGCGGCAGCCGGGCTGCCGGATCACGGCGGCTCGGTCGACTGGTGGT
TGACCAACGATGCGGTGCTGATCGACACGGCCGGCCATTACACGCGTCACGGCACGTCGGCGCACGCGGC
GCCGCTGCCGCCCGCCGGGCCCGCGCCGCACGCCCAGCCCTTCGACGCGGCCGCCGACGCGCGCCGCGCG
AACGGTCAGCCGGCGGGCGAGCGGCACGCCGTCGCGATGGCCGCGGCGGCGCCGTCGAACGCCGCGTTCG
TCGACGAGCGGCTGGCGCAATGGCGGCAGACCGTCGACCAGGCCGAATGGCTGGGCTTTCTGCGGACGCT
GCGCAAGCATCGGCCGCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCACGCTCACGAGC
GCCGACGACAATGCGCGCCATGCCGAGGCAGCCGCGCTGCGCGCGCGGCTCGCCGATCTGCGCGCGCAAC
TGGGCGTGCGCTTTCCCGTCTATCTGATCGTCACGAAGACGGACCAGTTGCCGGGCTTCGCCGAATACTT
CAGCGCGCTGACCACGGAGGGCCGCGCGCAGGCGTGGGGGTTCACGCTGCCGTACGACAAGGAGACCATC
GCGGACGAAGGCGTCCACGCGCGCTGCGCCGACGAGCTGCGCGCGTTGGCCGCGCGGCTCGCCGCGGGCG
TGAACACCCGCCTGCAGGAAGAGCACGACACGCAGCGGCGCCGCCGGCTCGCCGCGCTGCCGGAGGAATT
TCTCGTGCTGACACGCCCGCTCGGCGAGCTGATCGATCGCGTCTTCGCCGATTCCCGCTACGACGACACG
CAGCATCACGCGACGCTGCGCGGCGTGTATTTCACGAGCGCCGCGCAGACGGGCGGCGAGGCCGCCGCCG
AAACGCGCACCGTCGCGCGACGCCTCGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCGCGCGCGCGGC
GCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCCGGACGCACGC
CTCGTCCAGCCGAACCTTCGCTGGGAGTATCGCTCGCGCACGCTGAGCCTCGCCGCTCACGCGCTCGCGC
TGCTGCTGTTCGCGTGGGTCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGATGCCTATCTCGACGC
GCTCGCGCGCAAGACGGCGGCGCTCGCCTCCCGGGTCGACCAGTTGTACAAGGCGCCGAAGCCCGAGGCC
GTGCCCGACGTGCTGACGCAAGCCCGCTCGCTGAGCGCGTACCCGGGCCTCGATCTGTCCGCGCCGGGCA
GCGGCTGGCGGTTCGGCCTGTACACGCCGCCCGGCATCGTCGCCGAAAGCAGCCGCACGTACGACGCGCT
CGAGGACACCCTGCTGCTGCCGCGGATCGTCACGCGCATCGAGGCGGTGCTGTCGCAGGCGATCGCCGAT
CGCGATCCGAAGGCCGCGTACGACGCGCTGCGCGTCTATCTGATGCTGTACGACCGGGCCCGCTTCGATG
CCGCGCAGGTCGAGGCGTGGGTGCTCGACGACTGGGCGCGAACCGACAGCGCGGCGGTCTTCGGCGGCCG
CGCGTCGATGATCGCGCACGTCGAGCAACTGTTCCGCGGCGAGCGCATCGTGCAATCCCCGCTGATCCGC
AACGATGCGCTGATCCGCCAGGCGCGCGCGTTCCTGGACGGCAGCAACGCGACCGAGCGGCTCTACGAGC
GCGCGAAGGCGGCGATGGATAAAGAAGCGCCCGACGAGTTCACGCTGCTGCGGGCCGTCGGCCCGCAGGC
CGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGGGGCGTGCCGGGCCTCTTCACGTTCGAC
GGATACCGGCGCGTGTTCGACAAGCGGCTCGCCGAATTCGTGCGGACCGCGCGCGAAGACGATGCATGGG
TGATGGGCCGCGCGTATCTCGGCGACGCTCAAAAAAAAACGGCTGAGATCGCGAATGCGCTCGCGGGGGC
CGACGATCCGCTGACCGACGCGATCCGCCGGCAATATCTGATCGAATACGCGCAGCAATGGGACGCGTTT
CTCGGCGACATCCGCACGATCGGCGGCACGAGCCTCGCATTCGATCTCGTGGTGCTGCGCAGCTTCGCGG
CGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGACGCTCGCGCAGCCCGAAGC
GAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCAGGCGGACAAGGCGCTCGGC
GTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCGGGCCTGCGCGAAATGGTGA
CGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCAAGAGCGGGCTCGATGCGGT
CGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGCGCTCGCGAACAACAGCATG
CCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATGCCCGCGCCGTTTCGCTCGG
TGCTGACCGGGCTCGCCGCACAGGGCTCGCGCGAAGTGAACCGCGGCATCGGCCAGTTGCTGTCGCGGCA
GTTGCAGGCGACGGTAGGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTATCCGTTCGCGCCCGACAGC
AAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGCGTGATCGACGACTTCTTCG
CGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACAAGACGCTGCCCGGCGCGAC
CGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGATTCGCGAAGTGTTTTTCGGC
GCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAACTGGACCCGACGATCACGA
GCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCGTCGCGCCGTTCGCGGTGAG
CTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGAGATCACCGCGAGCCCGCGCATCCGGCCGGACACGTCG
GCGGTGTCGACGGACGGCCCATGGGCGCTGCTGCGCCTGCTTCAGAAGGGACGCGTGAGCGGCACGGCGA
CGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGCTCGACCTCGCGAGCACGGG
CAGCGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCCGGGCTCGATGCCGATGTTC
AGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCGGCGCCGGCGTCGCGCGTCG
CGCGCGACGGGCGGTGA
 Primer design