SecReT6
Protein ID: 386863920
SecReT6 ID645
T6SS typei3
Gene symboltssL-3
Locus tagBP1026B_II0189
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]225257..226537 [-]
Producttype VI secretion system
NoteTssL
UniProt IDI1WQC6
KEGG IDbpz:BP1026B_II0189
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-68, Aligned region: 51..261
OmpA [PF00691], Evalue: 3.50E-17, Aligned region: 320..418
Protein Sequence: 426 a.a.     [Download]
>gi|386863920|ref|YP_006276868.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MTSETVHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPER
LDRDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGL
ATSFHEDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIAS
QRGPVSVALSPHWQPGPRNRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAP
PAAPAELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIARVPGKV
TVRGYTDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRV
EITVAR
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c226537-225257 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGACCTCAGAAACCGTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGA
CGTTCGCGCGGCGCGAGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAG
GCTCGCCCGCAACCCGCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGG
CTCGATCGCGACGACATTCCGCAATTGCGACTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCT
GCGAACAGGCGAACATCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGA
GGCGGCGATGCAGACGTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTC
GCGACGTCGTTCCACGAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATT
CGCCGCACGAGCACATCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTA
CCGTTACGAAGCCGACGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCG
CAGCGCGGGCCGGTGTCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAACAGGAGCGCGCCGT
TTCGCGATTTCCCCGCGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTT
CAAGTACGCGCTGTCGACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCG
CCCGCCGCGCCGGCCGAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCAGGCACGCTCAGCG
TCGAGGAAAACGCGCGCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGG
CGTGAACCCGGCGATGGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAGGGTGCCGGGCAAGGTG
ACGGTGCGCGGCTACACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCG
AAGAGCGCGCGACGCAGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCT
CGGCAAGGGCGGCGCCGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTC
GAAATCACGGTCGCGCGCTGA
 Primer design