SecReT6
Protein ID: 386863930
SecReT6 ID645
T6SS typei3
Gene symboltssE-3
Locus tagBP1026B_II0199
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]236482..237063 [+]
Producttype VI secretion system
NoteTssE
UniProt IDI1WQD6
KEGG IDbpz:BP1026B_II0199
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.30E-18, Aligned region: 60..170
Protein Sequence: 193 a.a.     [Download]
>gi|386863930|ref|YP_006276878.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MDAHETRADAPRNGDEARVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|386863735|ref|NC_017832.1|:236482-237063 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGCGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAGCTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCCGA
GGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGCCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA
 Primer design