SecReT6
Protein ID: 386863931
SecReT6 ID645
T6SS typei3
Gene symboltssF-3
Locus tagBP1026B_II0201
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]237094..238983 [+]
Producttype VI secretion system
NoteTssF
UniProt IDI1WQD7
KEGG IDbpz:BP1026B_II0201
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-214, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|386863931|ref|YP_006276879.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFEL
LHVAGVATLTAAPGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALSVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|386863735|ref|NC_017832.1|:237094-238983 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGGACCCGCAATTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCG
CGCGCGCGCACCCGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGC
TTCACCGGCCGCCTGCTCGAGGTGCTCTATCCGAACTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGC
GCCTGTACCCGAGCCGCACCGAAGGCAATCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGC
CGCGCGCGTGCCGGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCGGCGCGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACATGCGCATCGCCGATCT
GCGGGGCCTCGACCGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCCGCCCGCCCG
CGGCGGTTACCGTCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTG
GGCGAAGTTCCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAAC
AATCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTCCGCGCCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGG
CCGAACTCGAGTTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGC
ACGGAGATGTTCGTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGG
TGGACGCGCTGGTGACGAACCGCGACCTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGC
GATCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCG
GCGGCAGGTGGAAAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAACGGGCTTCTCCGGCGTGAGCCCGT
ATCTGTTCGGGCTCGTGCTCGAGCATTATCTAGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGCCGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA
 Primer design