SecReT6
Protein ID: 386863933
SecReT6 ID645
T6SS typei3
Gene symboltssA-3
Locus tagBP1026B_II0202
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]240131..241168 [+]
Producttype VI secretion system
NoteTssA
UniProt IDI1WQD9
KEGG IDbpz:BP1026B_II0202
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 46..106
ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 118..132
ImpA-rel_N [PF06812], Evalue: 7.20E-21, Aligned region: 182..198
Protein Sequence: 345 a.a.     [Download]
>gi|386863933|ref|YP_006276881.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWSDVERDCRRLMMRSKDMRLAVLF
ARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIRRNALQALTDADGLLADVREIAL
TRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAGFGDALAGLAAIDAWSGEHLGDY
APDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAHASPPRRREPAAQALAAAIAGEP
AAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADVVQAIPAELLALWSADET
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|386863735|ref|NC_017832.1|:240131-241168 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGCGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCG
CGGCGAAAGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTG
GAGCGACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTC
GCGCGCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGC
TCGCCGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGAT
CCGGCGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTG
ACCCGCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCG
ATGCGCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGC
GGGCTTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGACGCCTGGAGCGGCGAGCATCTCGGCGATTAT
GCGCCGGACCTGTCGGCGCTCGATGCGCTGCTTCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCG
CGGAGGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGCGCACGC
ACACGCATCGCCGCCGCGGCGGCGCGAGCCTGCGGCGCAGGCACTCGCGGCTGCCATTGCGGGCGAACCG
GCCGCGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGC
ACGAGCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGA
TGTGGTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCGCGGACGAAACCTGA
 Primer design