SecReT6
Protein ID: 386865292
SecReT6 ID647
T6SS typei1
Gene symboltssM-5
Locus tagBP1026B_II1604
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2030240..2034286 [+]
Producttype VI secretion system
NoteTssM
UniProt IDI1WU98
KEGG IDbpz:BP1026B_II1604
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.40E-49, Aligned region: 170..415
ImcF-related_N [PF14331], Evalue: 8.40E-49, Aligned region: 1107..1147
Protein Sequence: 1348 a.a.     [Download]
>gi|386865292|ref|YP_006278240.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLPA
ADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRHARDDAA
IAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHAFLEQLGRARARRGVNGVVVAIDAPRLIEASR
DALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVAR
ALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGRQ
AGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASVA
AGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVGR
LEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDMRAADDARLAARIRNLVRYVNLMQARRRGADRETLA
QMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGGVGGVGGVGGVGGVGGVGGVGGVGGVGGVGGVGGV
GGARAAEGAGRAVRASGGRRAGDARAARGMRGAAGNASAGAEIAPAADGVRDRDEGFARVSALAVDLIAW
SAPDDRALAARVAAAQAELERLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVR
VPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWR
AVIDRIADRRDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSI
SRSGGRALREALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSV
QASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATR
DDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAER
RAQQQAALELDERIASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLR
VSEQIDWQPDRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHI
DVRYDFSGHDALLAHVGRIDALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIG
VCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 4047 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2030240-2034286 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCGACT
GGCCGCTGTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGCGCG
CCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCGTCCGAGCGCCTGCCCGCG
GCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGCAGC
CCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTACCGTGGTATCTCGTGATCGGCCCCGAGGGCGC
GGGCAAGACGACCGCGCTCGCGCGCGCGCGCCTCGTGTCGCCGCTGCGGCACGCGCGCGACGACGCGGCC
ATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCCGCT
TCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGTTCCTCGAGCAGCTCGGCCGCGC
GCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGCCGC
GATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACCGGC
GCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCAGCT
CGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCGCGC
GCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGCCGT
CGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACGCGC
GGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGGCAG
GCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCGATG
CGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGTCGA
GCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTCGCG
GCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACTATC
CCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGTGAT
CGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGCCGG
CTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATCGGC
TGTTCTTCGGCGAGCCGGACGGCGCGAGCGACATGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCGCAT
CCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTCGCG
CAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGGGTG
TTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGG
CGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTAGGCGGTGTA
GGCGGTGCGCGCGCCGCGGAAGGCGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACG
CGCGCGCCGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCAGCGCCGGCGCTGAAATCGCACCCGCCGC
AGACGGCGTTCGCGATCGCGACGAAGGGTTTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGG
AGCGCGCCCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGT
ACCGCGATCCGGACGGCGCGTGGCTGCTCGCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGC
CGATTTCTGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGC
GTGCCCGCCGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGG
TCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGA
CGCATGGCGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGC
GCGGTGATCGACCGGATCGCCGATCGCCGCGATCCGTTCGCGGCATTGCTCGCGCGCGTCGATCGCGAAT
TCGAATCCGAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGC
CCCCGCGATGCTCGCGCCCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATC
TCGCGCAGCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCCCCCGAGCAAGGCAGGCTCACGCTCG
AGCGCGACGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGC
GCTCGCGGGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTC
CAGGCTTCCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACG
TCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCA
GGCGTCGTGCGCACTGCAGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGC
GACGACGTGGAGGGCTTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGC
CGTTCGTGCGTGTCGGCGCGGCGCGTGCATCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGA
CGCGTTCCTGCCGCTCATCGACGACGCGGCCGCCCGTCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGG
CGCGCGCAACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGC
TGCGCGCGCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAA
GCCGTTCGAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGC
GTGTCCGAGCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCG
TCACGCTCGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGT
GCGCCGCTTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATC
GACGTGCGTTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAAC
GCGCGCGCCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGC
GACGGCGATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGC
GTGTGTTGGGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTGA
 Primer design