SecReT6
Protein ID: 386865915
SecReT6 ID648
T6SS typei3
Gene symbolclpV-6
Locus tagBP1026B_II2255
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2798027..2800693 [-]
Producttype VI secretion system
NoteTssH
UniProt IDI1WW21
KEGG IDbpz:BP1026B_II2255
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 229..248
AAA_2 [PF07724], Evalue: 1.00E-38, Aligned region: 616..782
AAA [PF00004], Evalue: 2.60E-19, Aligned region: 230..332
AAA [PF00004], Evalue: 2.60E-19, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 213..224
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 788..862
AAA_5 [PF07728], Evalue: 1.50E-11, Aligned region: 230..249
AAA_5 [PF07728], Evalue: 1.50E-11, Aligned region: 620..738
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 230..310
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 370..396
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 516..547
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 617..646
AAA_22 [PF13401], Evalue: 3.30E-09, Aligned region: 681..703
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 37..58
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 102..162
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 207..246
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 375..396
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 443..546
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 615..664
AAA_16 [PF13191], Evalue: 9.20E-09, Aligned region: 685..703
Sigma54_activat [PF00158], Evalue: 8.60E-07, Aligned region: 225..245
Sigma54_activat [PF00158], Evalue: 8.60E-07, Aligned region: 603..728
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 224..251
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 619..642
IstB_IS21 [PF01695], Evalue: 1.90E-06, Aligned region: 730..751
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 614..642
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 231..247
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 375..405
AAA_17 [PF13207], Evalue: 4.60E-05, Aligned region: 619..656
Zeta_toxin [PF06414], Evalue: 7.70E-05, Aligned region: 230..247
Zeta_toxin [PF06414], Evalue: 7.70E-05, Aligned region: 619..660
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 287..310
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 618..737
RuvB_N [PF05496], Evalue: 0.0002, Aligned region: 229..245
RuvB_N [PF05496], Evalue: 0.0002, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 0.0002, Aligned region: 583..641
RuvB_N [PF05496], Evalue: 0.0002, Aligned region: 689..818
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 228..254
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 366..394
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 518..539
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 596..643
AAA_25 [PF13481], Evalue: 0.0002, Aligned region: 793..829
AAA_29 [PF13555], Evalue: 0.00065, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.00065, Aligned region: 615..645
AAA_18 [PF13238], Evalue: 0.00069, Aligned region: 231..249
AAA_18 [PF13238], Evalue: 0.00069, Aligned region: 621..649
NACHT [PF05729], Evalue: 0.0033, Aligned region: 230..256
NACHT [PF05729], Evalue: 0.0033, Aligned region: 289..337
NACHT [PF05729], Evalue: 0.0033, Aligned region: 620..648
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 230..243
Hpr_kinase_C [PF07475], Evalue: 0.0047, Aligned region: 621..638
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 127..154
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 208..243
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 287..314
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 618..641
Protein Sequence: 888 a.a.     [Download]
>gi|386865915|ref|YP_006278863.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSDIGRVTLFGKLNTFLYETLEQATGFCRLRGNPYVELAHWLNQMLRRPDSDVHRILRRFDIDAAAIDRG
IVSALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDAAQIRGAVLLLALVKTPQLRNVLYAIARDFER
IVPDVLADELERIVAGSPEAPSPAARAAAGAIGDAGAAPSAAREGSALARYAIDLTARARAGEIDPVVGR
DGEIRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKG
EFESRLRGVIDEASSSERPVILFIDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYI
EKDPALTRRFQLVQVREPEEGAALAMLRGLAAKLEAHHRVLVLDDALQAAVTLSHRYIPARQLPDKAISL
LDTACARVAVSQHAVPAPIEDVRRRIDSLRVERELIARECALGAGDAQRLDAIDASIAGEQTTLDALDAR
WQAERDALGKIVDWRASLLADDSSRVLDEAARADVQAKLSAALRALAELQGETPLVLPAVDTHAVAAVVS
DWTGIPLGRMVRDEMQSVLKLAETLAERVVGQPHAVGLIAERIQTARARLDDPAKPHGVFLLCGPSGVGK
TETALALAETLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEK
AHRDVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTSNVGSERVMQLCRDPQRLPDAQTLTDALRAPLRE
VFPAALLGRLTVVPYYPLTDEMLARIVALQLARIERRIEAHHGIALRCADSATALIAERCRTIESGGRMV
DAILTHTVLPRISQEILRATIEGRALRAIDVSAEDGQFVYRFEEEGAT
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2800693-2798027 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGTCCGATATCGGCCGAGTGACCTTGTTTGGAAAACTGAACACTTTTCTCTACGAGACCCTGGAGCAGG
CGACCGGCTTTTGCCGGCTGCGCGGCAATCCCTATGTCGAGCTCGCGCACTGGCTGAACCAGATGCTCCG
GCGCCCGGACAGCGACGTGCACCGGATCCTGCGCCGCTTCGACATCGACGCGGCGGCGATCGACCGCGGG
ATCGTTTCGGCGCTCGACCGGCTGCCGCGCGGCGCGGGTTCCGTGTCCGATCTGTCCGCGCACATCGATG
ATGCGGTCGAACGCGCATGGGTGTACGCGACGCTCAAGTACGACGCGGCGCAGATTCGCGGCGCGGTGCT
GCTGCTCGCGCTCGTGAAGACGCCGCAGCTGCGCAACGTGCTGTACGCGATCGCGCGGGACTTCGAGCGC
ATCGTGCCTGACGTGCTTGCCGACGAGCTCGAACGGATCGTCGCAGGCTCGCCGGAGGCGCCGTCGCCCG
CCGCGCGCGCGGCGGCGGGGGCGATCGGCGACGCGGGGGCGGCGCCGTCCGCCGCGCGCGAAGGCTCGGC
GCTCGCGCGCTACGCGATCGATCTGACCGCGCGTGCGCGCGCGGGCGAGATCGATCCGGTGGTCGGCCGC
GACGGCGAGATTCGGCAGATCGTCGACATCCTGCTGCGCCGCCGGCAGAACAATCCGCTGCTCGTCGGCG
AGGCGGGCGTCGGCAAGACCGCGGTCGCCGAAGGCTTCGCGCTGCGCATCGTCGCGGGCGACGTGCCGCC
GCCGCTGCGCGACGTCGAACTGTATCTGCTCGACATCGGCCTGCTGCAGGCGGGCGCGAGCGTGAAGGGC
GAATTCGAGAGCCGCCTGCGCGGCGTGATCGACGAGGCGAGTTCGAGCGAGCGGCCCGTCATTCTGTTCA
TCGACGAGGTACACACGCTCGTCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCGAACCTGTTGAA
GCCCGCGCTCGCGCGCGGCCTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAATACAAGCAATACATC
GAGAAGGACCCGGCGCTCACGCGGCGCTTCCAGCTCGTGCAGGTGCGCGAGCCGGAGGAGGGCGCGGCGC
TGGCGATGCTGCGCGGGCTCGCCGCGAAGCTGGAGGCGCACCATCGCGTGCTCGTGCTCGACGATGCGCT
GCAGGCGGCCGTCACGCTGTCGCATCGCTACATTCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTG
CTCGACACCGCGTGCGCGCGCGTCGCGGTCAGCCAACACGCGGTGCCCGCGCCGATCGAGGACGTGCGGC
GGCGGATCGATAGCCTGCGCGTCGAGCGCGAGCTGATCGCGCGCGAGTGCGCGCTCGGCGCGGGCGATGC
GCAACGGCTCGATGCAATCGATGCATCGATCGCCGGCGAACAGACCACGCTCGATGCGCTCGACGCGCGC
TGGCAGGCGGAGCGCGACGCGCTCGGCAAGATCGTCGACTGGCGGGCCTCGCTGCTGGCCGACGATTCTT
CGCGCGTGCTCGATGAGGCGGCGCGCGCGGACGTGCAGGCGAAGCTCTCGGCCGCGCTGCGCGCGCTCGC
CGAATTGCAGGGCGAGACGCCGCTCGTGCTGCCCGCGGTCGATACGCACGCGGTGGCCGCCGTGGTGTCC
GACTGGACCGGCATCCCGCTCGGGCGGATGGTGCGCGACGAGATGCAATCGGTGCTGAAGCTCGCCGAGA
CGCTCGCCGAGCGCGTGGTCGGCCAGCCGCACGCGGTCGGGCTGATCGCCGAGCGCATTCAGACCGCGCG
CGCGCGGCTCGACGATCCGGCCAAGCCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAG
ACCGAGACGGCGCTCGCGCTCGCCGAGACGCTGTACGGCGGCGAGCACAACGCGATCACGATCAACATGA
GCGAGTTTCAGGAGGCGCACACCGTATCGACGCTCAAGGGCGCGCCGCCCGGCTACGTCGGCTACGGACA
GGGCGGGGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGTGTCGTGCTGCTCGACGAAATCGAGAAG
GCGCACCGCGACGTGCACGAGATCTTCTTTCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGGC
GCTATATCGACTTTCGCAACACGGTGATCCTCCTCACGTCGAACGTCGGTTCCGAGCGCGTGATGCAGCT
GTGCCGCGATCCGCAGCGCCTGCCCGATGCGCAGACCTTGACCGATGCGCTGCGCGCGCCGCTGCGCGAG
GTGTTTCCCGCCGCGTTGTTGGGACGCCTGACGGTCGTTCCGTACTACCCGCTCACCGACGAGATGCTCG
CGCGGATCGTCGCATTGCAGCTCGCGCGCATCGAGCGGCGCATCGAAGCGCACCACGGCATCGCGTTGCG
CTGCGCGGATTCGGCGACCGCGCTGATCGCCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGCATGGTC
GACGCGATTCTCACGCACACGGTGCTGCCGCGCATCAGCCAGGAGATCCTGCGCGCGACGATCGAGGGGC
GCGCGCTGCGGGCGATCGACGTGAGCGCCGAAGACGGCCAGTTCGTTTACCGATTCGAAGAGGAGGGCGC
GACGTGA
 Primer design