SecReT6
Protein ID: 386865916
SecReT6 ID648
T6SS typei3
Gene symboltssG-6
Locus tagBP1026B_II2256
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2800706..2802118 [-]
Producttype VI secretion system
NoteTssG
UniProt IDI1WW22
KEGG IDbpz:BP1026B_II2256
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.90E-130, Aligned region: 74..428
Protein Sequence: 470 a.a.     [Download]
>gi|386865916|ref|YP_006278864.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MDAGSHANSNAGRRAGAAANAEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATSQAAAARRDAWW
RRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGPRPRVAIH
GFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPARARFDRY
VASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSPPDSSPDSRSDSRSDSPSDARLDPHPDSPRGAGAL
APHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRPTQPLGGAVLGR
AVRDAQSRFRIVLGPLTLDEYRQFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEVPTLALGSRHGL
GRTAWLGERLGPGPARDLVLGYDERMRASRARSGAADQAAAAGAFDRQPA
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2802118-2800706 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCCGGCGCGCCGGTGCGGCCGCGAATGCGGAGGCGA
ACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGGCGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCC
GAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCGCAGGCCGCCGCCGCGCGCCGCGACGCGTGGTGG
CGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGTTTCATGCGCTGCGTTGGCTCGATGCGCTGTCGC
CCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCGCGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTC
GCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGTGACGACGGCCCGCGCCCGCGCGTCGCGATTCAC
GGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCGAGTACGCATACGAGCGCGCGA
CGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGACCTGTTTCATCATCGGCTGATCCTGCTGTTCTA
TCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTCGATCGGCCGGCGCGCGCGCGGTTCGACCGCTAC
GTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTGCCGATTCACCGCGCGGCTCACGGCCCGATTCGT
CCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACCGCCTGATTCATCGCCTGATTCGCGGTCTGATTC
GCGGTCCGATTCCCCGTCCGATGCGCGCCTCGATCCGCATCCCGACTCGCCGCGCGGCGCTGGCGCGCTC
GCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGGTGCGGCACACGCGCAACCCGGAGGGGCTCGTGC
AGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCATCGTCGAGCACGTGCCGCACTGGGTGATGCTCGA
TCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGT
GCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGCTCGGCCCGCTGACGCTCGACGAATACCGGCAGT
TCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCAATGGGTGCGCGAATACGTCGGCATCGAATTCGA
CTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTGCCGACGCTCGCGCTCGGCAGCCGTCACGGGCTC
GGCCGCACCGCATGGCTCGGCGAGCGGCTCGGCCCCGGCCCCGCGCGCGACCTCGTGCTCGGCTACGACG
AGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGCCGATCAGGCGGCCGCCGCCGGTGCGTTTGATCG
CCAACCTGCCTGA
 Primer design