SecReT6
Protein ID: 386865918
SecReT6 ID648
T6SS typei3
Gene symboltssE-6
Locus tagBP1026B_II2258
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2804024..2804560 [-]
Producttype VI secretion system
NoteTssE
UniProt IDI1WW24
KEGG IDbpz:BP1026B_II2258
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-22, Aligned region: 42..156
Protein Sequence: 178 a.a.     [Download]
>gi|386865918|ref|YP_006278866.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MRAAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGEDGFVDWSA
FAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERRHNVL
MFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 537 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2804560-2804024 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGCGAGCCGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCGACCGGCTGACCG
ACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCGCCTGCGCGCGGC
GGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTCGACTGGTCGGCG
TTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGCCGATGTCGGGCG
TCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCGTTTCGAGCCGCGTATCGCGCCCGA
CAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCGGGCGAGCGCCGGCACAACGTGCTG
ATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCGAGTTCGTGCTGCGCTCGGACCTCG
ATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTGA
 Primer design