SecReT6
Protein ID: 386865920
SecReT6 ID648
T6SS typei3
Gene symboltssC-6
Locus tagBP1026B_II2260
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2805142..2806650 [-]
Producttype VI secretion system
NoteTssC
UniProt IDI1WW26
KEGG IDbpz:BP1026B_II2260
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|386865920|ref|YP_006278868.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAAGE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2806650-2805142 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAATGAACGTGCCCAAACCCAGGCCGACACGCGCGCCGCCGCCCAGCCCGTGGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAAAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCATCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGCCTGCACTACCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCACTGCCCGCGTCGCGCAACGAGCTCGCGCGCACGCTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCCATTTCAACCACAGTCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCAGCCGCGCATGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTCGCCAATCCGCGTGATCTGACGAAGATCTTCCAGAACACCGAATACGCCGCGTGGCGCAGCCTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAGGATACCGGCGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTGCAAGGGCTGCCGTGCCACACGTTCCCCACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTCGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAGCTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGGGCGAATGA
 Primer design