SecReT6
Protein ID: 386865925
SecReT6 ID648
T6SS typei3
Gene symboltssM-6
Locus tagBP1026B_II2265
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2812174..2815803 [-]
Producttype VI secretion system
NoteTssM
UniProt IDI1WW31
KEGG IDbpz:BP1026B_II2265
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|386865925|ref|YP_006278873.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFVAWGARIAWRG
WRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLA
SQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2815803-2812174 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGACATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGTTTCGTTTGGCTTGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCGCCCGTTCGAGAG
CGGCGCGGTGCGCGCGGCGACGATCGTCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCGGC
TGGCGCGCGGGGCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCCGCGA
CGGGCGATCCCGCGCAGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCCGCGACGCTGTTGAA
GAAAGTCCGTTTCGGCGAAGCCGACGGCGCGCGCAAGGGCCTGCCGCGGTGGCTCGAGCAGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTACACGACGCAC
GAGAGCAACCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCGCGCAGCTCGGCATCCGCTTTCCG
GTGTATCTGCTCGTGACGAAGGCGGATTTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAAGCGCCCGGCTTCGAGCTGCG
CGCGGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTGCCGGAGCTGCTCGCA
TCGCAGACCGACGCGCGCCAGCGCGAGATGACCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
CTATCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGTCGGGCCGCAGTTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTTCGCGAGGCGGCGCTTGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGTGC
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGCGTGGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGACTATCTCGACGAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCGAAATTCACGGGCGCGGCCGACATCGTGCAGCTGCTGCCGGTGCTCGACGAGCTGAGCGGCCTGCC
GAACGCGGGCGGCGTGGACTTGCGGCATCCGCCGCTCGCGTATCGCTGGGGCCTGTTCCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTCTACCGGCGCGCGCTCGATGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGACGCGCGGCCCGACGAGGTCGAGTATGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTTTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCGGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCGCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTTCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTATCGGCAGCTCGCGCGCACGCTGCACGCGAGCACCGCGTCGTAC
GATTTCAGCGTCGCGCGCGCGGTGGGGCCGGACGCGTCGCTCGTGTTCCGGCGGCAGAGCGGCAAGAGCC
TCGCCGACGGCGTGCCGGGCCTCTACACGCGCAGCGGCTACCGCAACGTGTTCGCGCCGCGTCTGCCCGG
CGCGATCGATTCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTACCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAATCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAACTCGCTCGCGC
AGATCTTCGCCGGGCAGCCGGGCGGCGAAGCGGGCGCGGCGGCCGCGCCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGGGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCGACCGACGACGCATTGCGCAGCGGCG
CGGCGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGTTGCCGACGCCTGTGCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCATCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTACCCGTTCGCGCGCG
GCGCGGCGCGCGACGTCGCGCCGTCCGACTTCGCGCAGCTGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCATCCGTGGCGTTTCAACAACCGCAACGCC
GAAGCCGACCCGTCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCGGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
GGAGATGCTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGGGCGACGGGCG
GCTTCACGACCGAGGGCCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGTGGGCGCGG
ACCCGAGCAGATGGTCGCGAGATTCGCGGTCGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design