SecReT6
Protein ID: 386865928
SecReT6 ID648
T6SS typei3
Gene symboltssJ-6
Locus tagBP1026B_II2268
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2818538..2819113 [-]
Producttype VI secretion system
NoteTssJ
UniProt IDI1WW34
KEGG IDbpz:BP1026B_II2268
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-38, Aligned region: 33..179
Protein Sequence: 191 a.a.     [Download]
>gi|386865928|ref|YP_006278876.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSLREAGGHFIAMQGKRPKMRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSP
IVLKVFQLKTASAFESADFFSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVL
EKNRWRMTVPLPRAKQLNLYRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 576 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c2819113-2818538 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
TTGTCGCTGCGGGAAGCCGGCGGGCATTTTATTGCGATGCAAGGAAAGAGACCGAAAATGCGACCGCGGT
TCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTTGCCGGATGCGGGGCGACCGAGCGTTCCGTTGC
GGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCGCAAGCCGTCGCCG
ATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTCTTCTCGCTGCAGG
ACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGCGCCCGGGGGATGC
GCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGAATATCGCGTGCTC
GAGAAGAACCGCTGGCGGATGACGGTGCCCCTGCCGCGCGCGAAGCAACTGAACCTGTACCGATTCTGGC
AAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCCTCGGCGGCGATTC
GCGAGTACGCCAATGA
 Primer design