SecReT6
Protein ID: 386865930
SecReT6 ID648
T6SS typei3
Gene symbolfha-6
Locus tagBP1026B_II2270
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]2820152..2821588 [+]
Producttype VI secretion system
NoteFha
UniProt IDI1WW36
KEGG IDbpz:BP1026B_II2270
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-10, Aligned region: 29..96
Protein Sequence: 478 a.a.     [Download]
>gi|386865930|ref|YP_006278878.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATAAAAAAPAASAAQAQAKGAGNK
LWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREG
EGRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATP
ETLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPL
KLLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|386863735|ref|NC_017832.1|:2820152-2821588 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGTTTC
ATGCGCCGGGCGGCACGATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAGAT
TTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAAGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCGC
CACGGCGGCCGCGGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCAACAAA
CTGTGGGGCCTGCTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGC
GCGCCGCGCCGGCGCGCCACCACGATTCGCCGGCGTCCGCCGCGCCGCGCGACCTGAATCAGCTGTCGAC
CGATCCGCTCGACCTGTTCGCGCAGCCGCACGGCGATCCGGATGCGCGAGCCGGCGCCGCGCGCGAAGGC
GAAGGCCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAATGGACGCAACACGTCCGCGTGC
AGCCGGCGCAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCC
CGCAGCGGGCGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCC
GAGACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCTGCCGAGCAGCATCACTGGTCCG
CCGAGCAGTTGTTCGTCGCGGGGCAGCTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTC
ACGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTG
AAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACGC
CGCAAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCG
CGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCGCGCCCCAG
TGGTACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAACCACGCATCGCG
ACACGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGC
GGAAGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA
 Primer design