SecReT6
Protein ID: 387124418
SecReT6 ID651
T6SS typei4b
Gene symbol-
Locus tagABTJ_02407
StrainAcinetobacter baumannii MDR-TJ
Repliconchromosome [GenBank: NC_017847] [Browse all T6SS(s) in this replicon]
Location [Strand]2488507..2492331 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDI1Y269
KEGG IDabr:ABTJ_02407
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-72, Aligned region: 188..451
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 462..483
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 774..798
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 968..1080
Protein Sequence: 1274 a.a.     [Download]
>gi|387124418|ref|YP_006290300.1| type VI secretion protein IcmF [Acinetobacter baumannii MDR-TJ]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQRKKHAVQGEE
LAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
NGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFI
ATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRA
AVRFPALTVNQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRMLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMT
NLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQ
AFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFV
IRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSY
TVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGG
FEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|387122089|ref|NC_017847.1|:c2492331-2488507 Acinetobacter baumannii MDR-TJ chromosome, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGC
TTTAGGGCTCATCGCTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTTCAAGGTGAAGAG
CTTGCACAAGCGATTGAAAAGGATACCCAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAAC
TTATTAGCCAACAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAAAAGGGGAA
CGCAGCACTATATGAGTTGCCATGGTATATGGTCATTGGTAACCCAGCTGCTGGTAAAAGTTCTGCGATC
TATAATTCTGGTTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTA
CGCGTAATTGTGACTGGTTTTTTTCGACTGAGGGTATTTTACTCGACACCGCTGGACGTTATTCGGTCTA
TAGCGAAGACCACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCTAAGGCTCCAGTA
AATGGTTTAATTCTTATTGTTAGTATTGCTGAGCTTGTTAGTCAGAGTCCTGAACACTCATTAAAGCTTG
CGAAAAATTTACGCGCTCGTATTCAGGATTTAACCGAACGTTTAGAAGTGGTTGTACCCGTATATCTAGT
CTTTTCAAAAATGGATTTGATCGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGCACAAGAATATAAT
CAGGCGTGGGGCGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAAC
ACTACAATATTCTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAA
TATCTCACCTAGTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAACCTGCATTAAAAAGTTTTATT
GCGACATTGTTTGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACAAGTGCTT
TGCAAGAAGGCGTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGC
TCAAAGTGAAGTAAAAGATCAGCTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCA
GATGTCATTTTAAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATA
TTGCATTTATTGGTGCTTTAGCAGGCGTATCCATTATTCTCGGTGTGTGGGTTTGGTCATATCGTAATAA
TCAACAACTTATTGCCGAAGTTCAAGCTGATTTGAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAA
CAATTGTCGACTCAATTAGAGGCCTTACTTATCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATG
AAAATAGACCACTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGA
ATATTTAAAAGGTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGT
GTAAAAAATAACGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCTCAAACTC
AGCAATATTTAGAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGAT
GAGCAATCCACAGTATATGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTT
GATGCCAATAAAGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAA
TGACATTGGCAAATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCA
AGTATTGCTCTCTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATGAAATTAAAATGCGTGCT
GCTGTGCGCTTTCCAGCTTTAACTGTAAACCAGATTGTAGGTGACGCAAATAAAAATATTGTATTGGGTA
GTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAAGCAATTGAGGAAGC
AGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTCTCA
GGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAA
AATTCTTAAGTGGCATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATT
GGGCGAACCACAAAATTCACCAATTCGCATGCTTATTGAACGCGTAGCCATTGAAACAAACTGGGATAAT
CCGGTTGTTCAAGCAGAGTTAGCAGCGCCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAA
ACCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCA
AATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACG
AATCTTGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAATGCGATGA
CATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAA
GATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAA
GCCTTTGAAAGTTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAAC
CATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGA
AATTGGACAAATTCTTGGTGAGAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGACCCGTTTGTT
ATCCGCCGCGGTTATACCTTAACCTCCAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCACAATTTG
TTATGAACTTCCAACGCTATGTTGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCCAAGCACC
AGCTGCTCCGGCAACTAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAGTTACTTTCATAT
ACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTTATTTGGC
CAAATCAAGGCAGTATTCCGGGTGCTCGTATTACGGCTGTAGATTTACAAGGTCAAACACATACCATTTT
TGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAACGGTGGT
TTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTTATTAGTA
GTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAACTGCGGA
TAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAACTGAAAAT
CCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design