SecReT6
Protein ID: 387505144
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01065
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]245347..248871 [-]
Producthypothetical protein
NoteTssM
UniProt IDH6ML53
KEGG IDelr:ECO55CA74_01065
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-85, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 5.60E-85, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 2.50E-62, Aligned region: 205..455
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 0.00014, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 0.00014, Aligned region: 856..887
Protein Sequence: 1174 a.a.     [Download]
>gi|387505144|ref|YP_006157400.1| hypothetical protein ECO55CA74_01065 [Escherichia coli O55:H7 str. RM12579]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAA
WGIIALVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
ALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDY
QLLTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c248871-245347 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCCGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTATGGATCTGGTGGAAAGG
CCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGGTGTGGCTTACCGTCCGGGTAATGAAGCGCCTGCAACTGCTTGAAAAACAGC
AAAAACAGCAGCGCGAAGAGGCCATTGATCCGCTCAGTGTGGAGCTGAACGCCCAGCAGCGTTACCTTGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTACCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGACATTATTTATG
CCCCGGAGGGCGCGCGCGGCACAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
GCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTGACCGCAGACAAACGCCACCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACAGGA
TATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAGGGT
TTTGCCGCCCTGTTCCAGTCCCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCC
GTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCACCCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGACGGTGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGCGGGCAGATGGATGATATATTCACCCAGTCTGC
CGCCCGCCAGTACCGACTGGGCAATAACCCACTGGCGTCCTGGCCTCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCTTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGCGCCTGGCTGA
TGCGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACCGGCGGCGTGGCGGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GATGTGCCGCCTCCACAGGGGGAAGATGACTACGGCAACCTGCAACTGCCGCTGCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGACCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTTAAAGCGATGAATGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGA
TGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAGTTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCACGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTG
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAG
CGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGCTCACCGAGCAGTATATCAGCGACTAC
ACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGATGAGGCCCTGGCAGAGCCGGACTAC
CAGTTACTCACCCGTCTCGGGCATGAGTTCGCCCCGGAAAACATTACCCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGC
GCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCTGTACATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACT
GGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACA
GCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCT
GACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTG
GCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design