SecReT6
Protein ID: 387505145
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01070
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]248890..250302 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDH6ML54
KEGG IDelr:ECO55CA74_01070
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 152..183
Protein Sequence: 470 a.a.     [Download]
>gi|387505145|ref|YP_006157401.1| ImpA domain-containing protein [Escherichia coli O55:H7 str. RM12579]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAQLDIPELQRRGLQLLASES
KDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYWTVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATT
QRDTLLGELAKLAQCWQSHNVPELAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQP
SAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSAD
MVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGL
LFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c250302-248890 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAAAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGGACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGGTC
TCTGGCCCACGCTCAGCTTGATATTCCCGAACTACAACGCAGGGGGCTACAGCTTCTGGCTTCTGAAAGC
AAAGACTTCAGGCTACTGGCACACCTGCTCAGAACCCTGCAACATGCCGGTGATCCACTGCTGGCACTGC
ACCTGCTAACGCTATACGTGGAACATTACTGGACTGTGGCCGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGATCATTAAACGTTTTGAAACGGGTATTGAAGGCTTTTCACAAAACGCTGCCACAACG
CAGCGCGATACTCTGCTGGGTGAGCTGGCGAAACTGGCGCAGTGCTGGCAGTCACATAACGTCCCGGAAC
TGGCACAGGCTACCGATGATCTTTTTGCCCTGTACCAGCGTACGTTTAATCGTGCGGCTCCTGCTCCGGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAAACCACCGTCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCGCCATGCCCTGTG
GCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCGGTCTCTGCCGAT
ATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGGTTGAGAAAAGCG
TATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCGTCTGGGTTACAA
ACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTTCGCCCGACGGCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGCTGGGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACCGGATGTTGTTGA
TGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGAACAAAAATTCAC
GGCAGAACAATAA
 Primer design