SecReT6
Protein ID: 387505147
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01080
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]251047..253818 [-]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDH6ML56
KEGG IDelr:ECO55CA74_01080
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.10E-38, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 8.10E-38, Aligned region: 646..807
AAA [PF00004], Evalue: 2.70E-15, Aligned region: 223..334
AAA [PF00004], Evalue: 2.70E-15, Aligned region: 652..769
AAA [PF00004], Evalue: 2.70E-15, Aligned region: 780..843
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 813..889
AAA_5 [PF07728], Evalue: 1.20E-11, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.20E-11, Aligned region: 651..771
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 622..692
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 717..745
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 1.70E-05, Aligned region: 651..740
AAA_25 [PF13481], Evalue: 0.0012, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 0.0012, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 0.0012, Aligned region: 646..680
AAA_25 [PF13481], Evalue: 0.0012, Aligned region: 778..843
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 0.0021, Aligned region: 649..676
NACHT [PF05729], Evalue: 0.0054, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.0054, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.0054, Aligned region: 652..680
DUF258 [PF03193], Evalue: 0.0075, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.0075, Aligned region: 652..670
Protein Sequence: 923 a.a.     [Download]
>gi|387505147|ref|YP_006157403.1| type VI secretion ATPase, ClpV1 family protein [Escherichia coli O55:H7 str. RM12579]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLLARYAKNMTEDARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESEQDNTGAVPADETDREQPEETAETVSPVQRL
AQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASL
HKHLLTARADLRRPGRPLGAFLLAGPSCVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSP
PGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNL
GYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAE
VVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDA
QNDESVTKDETVL
 
Nucleotide Sequence: 2772 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c253818-251047 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCAGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
TTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCTTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCCTCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACAGAAGACGCCCGTAACGGCAGGCTAGACCCAGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAACTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCATCGGTGAAGGGTGAGTTTGAAAAACGCTTCAAGGGG
CTGATGGCGGAGGTCATTTCCTCTCCGGTGCCGGTCATTCTGTTTATCGACGAAGCGCATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTGAAACCGGCGCTGGCGCGTGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGCTTCCAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACAATTATTCTGCGTGGTCTGTCGG
CGGTCTATGAACGGTCTCACGGCGTGCTGATTGACGATGATGCCTTGCAGGCCGCAGCAACGCTGAGCGA
ACGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCTTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACTGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAACAGGATAATACCGGTGCCGT
ACCGGCTGATGAGACCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAGCGGCTG
GCCCAGCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGCACGTCGATAAAA
AACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTGTCGCAGAATGAAATGTC
GGTCATCACCGACCTGCCGAAATGGCTGGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTG
CATAAGCATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGGTGCGTTCCTGCTCG
CTGGCCCCAGCTGCGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCA
GTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGCTCCCCT
CCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACTGAAGCCATCCGCCAGAAACCCTACTCGGTGG
TGCTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTCCTCAACCTGTTCTACCAGGCGTTTGACAAGGG
CGAGATGGCCGACGGCGAAGGCCGCCTGATTGACTGTAAAAACATCGTCTTCTTCCTCACCTCCAACCTC
GGTTACCAGGTGATTGTCGAACACGCGGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGGTGCTGG
CGGACTTCTTTAAACCTGCCCTGCTGGCGCGAATGGAGGTGGTGCCGTACCTGCCGCTGTCGAAAGAGAC
GCTCGCCACCATTATCGCCGGGAAACTGGCCCGTCTGGATAACGTGCTGCGCAGTCGCTTTGGTGCAGAA
GTGGTCATTGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGA
TGCTGGAATCTGTCATCGATGGCGACATGCTACCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGC
TAACACGGCGATTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCT
CAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA
 Primer design