SecReT6
Protein ID: 387505149
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01090
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]254593..255924 [-]
Producthypothetical protein
NoteTssK
UniProt IDH6ML58
KEGG IDelr:ECO55CA74_01090
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|387505149|ref|YP_006157405.1| hypothetical protein ECO55CA74_01090 [Escherichia coli O55:H7 str. RM12579]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLYPQNFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
ARTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c255924-254593 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGCCCACACCATTTCCAGCAAC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATGATTTATCCTGGGGATTTAC
CGAACTCACCCTCAACAATGAACTGCTGGCGCAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCTGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGTACCCGCAAAATTTTC
CGGACGAAAGAAGCCGCAATATTTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATCTGCATTCAGAAGAAGGCGAC
GCGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGTGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGCGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGTATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTGCTTAACCGTAACCAGACCCGGTTTACCCATCGCGCCCGCCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGACCTTTACAGAGCCGTCA
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACACTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCGGTCAATCTGCCGCTGCATCTGCGTGACGG
CATCTGGCAGGCCGATGTTCATGACTCGGAACTGCTACAGTCTGCCACCTTTGTACTGGCCGTGGCAGCA
AATATGCCTGTCGATCAGATCCAGCGTCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATCCCGGGTATTCCTCTGCGCGCACTGATGGTGGCCCCCCGCCAGCTTCC
CTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGCCAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA
 Primer design