SecReT6
Protein ID: 387505150
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01095
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]255927..256451 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH6ML59
KEGG IDelr:ECO55CA74_01095
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|387505150|ref|YP_006157406.1| type VI secretion lipoprotein [Escherichia coli O55:H7 str. RM12579]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQT
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c256451-255927 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGCGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACTGAACCGGACACCAATACCAATGCGGAGGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCAGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGATAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGACC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA
 Primer design