SecReT6
Protein ID: 387505151
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01100
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]256448..257458 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDH6ML60
KEGG IDelr:ECO55CA74_01100
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 336 a.a.     [Download]
>gi|387505151|ref|YP_006157407.1| type VI secretion system protein ImpI [Escherichia coli O55:H7 str. RM12579]
MRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVV
NGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEM
AQRHLAVPPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNLLRRFVQYRRS
HELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c257458-256448 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
TTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTC
CCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCT
GCTATCAACGGAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTA
AATGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTT
CAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCC
GTTTATGGATCTGCCGCCCATTTATGCCAGCCCTGGCGATCATAATGATGACATCTCTGCGGCAGAAATG
GCGCAACGCCACCTTGCGGTCCCCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCGTGAGCAATTCCG
ACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTT
GCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAAC
ATGGATTACGCCACCGCGCTCGACGTGATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCG
CCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCGGCGATTGTGGAGTC
GCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGC
CATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGG
CCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTATGACCGGGTGCT
TCGTGAAAAACAGCGGGAGCCGGAAGCATGA
 Primer design