SecReT6
Protein ID: 387505154
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01115
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]260652..261065 [-]
Producthypothetical protein
NoteTssE
UniProt IDH6ML63
KEGG IDelr:ECO55CA74_01115
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.00E-18, Aligned region: 29..118
Protein Sequence: 137 a.a.     [Download]
>gi|387505154|ref|YP_006157410.1| hypothetical protein ECO55CA74_01115 [Escherichia coli O55:H7 str. RM12579]
MIPDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
FMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c261065-260652 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTCATTCGCTCAGGCAATCCATTCGCCAGAACCTAAGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TTCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA
 Primer design